Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7SNS5

Protein Details
Accession M7SNS5    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
43-68KMAEKMHKKRVERLKRKEKRNKLLNSBasic
NLS Segment(s)
PositionSequence
9-64REKEMKEEKEAERQKRVQAIKDKRAAKEEKERYEKMAEKMHKKRVERLKRKEKRNK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
KEGG ela:UCREL1_6933  -  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSTSATKAREKEMKEEKEAERQKRVQAIKDKRAAKEEKERYEKMAEKMHKKRVERLKRKEKRNKLLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.59
3 0.54
4 0.58
5 0.64
6 0.59
7 0.57
8 0.55
9 0.54
10 0.55
11 0.55
12 0.52
13 0.55
14 0.58
15 0.58
16 0.63
17 0.63
18 0.57
19 0.61
20 0.56
21 0.5
22 0.52
23 0.51
24 0.52
25 0.55
26 0.54
27 0.5
28 0.54
29 0.53
30 0.47
31 0.48
32 0.46
33 0.49
34 0.57
35 0.64
36 0.64
37 0.62
38 0.68
39 0.7
40 0.75
41 0.76
42 0.79
43 0.81
44 0.83
45 0.92
46 0.93
47 0.93
48 0.93