Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7S5I2

Protein Details
Accession M7S5I2    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
67-92HLDQKKEEKWQGEKRRRRRNLSDTSGBasic
NLS Segment(s)
PositionSequence
77-85QGEKRRRRR
Subcellular Location(s) nucl 17, cyto 5, mito 3
Family & Domain DBs
KEGG ela:UCREL1_11745  -  
Amino Acid Sequences MCYWGNSHSKCSAGEVEEAMEELGKSCGPLTAGWLFMEDWDKSYGLEVNGVEICPNLCWEFDHFCHHLDQKKEEKWQGEKRRRRRNLSDTSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.19
4 0.17
5 0.17
6 0.13
7 0.1
8 0.07
9 0.06
10 0.06
11 0.05
12 0.05
13 0.05
14 0.06
15 0.07
16 0.07
17 0.1
18 0.1
19 0.11
20 0.11
21 0.12
22 0.11
23 0.11
24 0.14
25 0.1
26 0.1
27 0.1
28 0.1
29 0.09
30 0.1
31 0.11
32 0.08
33 0.1
34 0.08
35 0.08
36 0.08
37 0.08
38 0.08
39 0.06
40 0.07
41 0.05
42 0.07
43 0.06
44 0.06
45 0.07
46 0.1
47 0.14
48 0.15
49 0.21
50 0.21
51 0.22
52 0.25
53 0.28
54 0.31
55 0.31
56 0.37
57 0.4
58 0.45
59 0.51
60 0.53
61 0.55
62 0.59
63 0.66
64 0.7
65 0.72
66 0.77
67 0.81
68 0.87
69 0.9
70 0.9
71 0.9
72 0.89