Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TCH3

Protein Details
Accession M7TCH3   
Localization Confidence High
Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
295-324AAVGDKRKRGRVVRMKPKKTARRGQEFEEEBasic
NLS Segment(s)
PositionSequence
140-157PRLAPKIRRREDTRERKA
296-317AVGDKRKRGRVVRMKPKKTARR
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR006958  Mak16  
Gene Ontology GO:0005730  C:nucleolus  
KEGG ela:UCREL1_8652  -  
Pfam View protein in Pfam  
PF04874  Mak16  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MASDEIVWQIINQQFCSFKLKTTKESTFCRNEYNVTGLCNRQSCPLANSRYATVRSSANGTLYLYMKTIERAHMPSKLWEKIKLSQNYQTALKQIDDRLIYWPKFLTHKCKQRLTRLTQVAIRMRNLAKEDARLGEKVVPRLAPKIRRREDTRERKAEAAAKLERTIERELIQRLREGAYGDQPLNVSETIWKKVLNSLEREGEAKRDKDLDKGIEDEEEEEEEDESEREYEREEEEEIEDGAVEYVSDFDESEDDLGDLEDWLGSDEPAGDDDDDESESEGSDGEDPAAKKTAAAVGDKRKRGRVVRMKPKKTARRGQEFEEEHEYAPRREELAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.32
4 0.26
5 0.29
6 0.37
7 0.41
8 0.46
9 0.53
10 0.6
11 0.6
12 0.66
13 0.68
14 0.67
15 0.64
16 0.62
17 0.56
18 0.51
19 0.47
20 0.46
21 0.38
22 0.33
23 0.34
24 0.31
25 0.33
26 0.32
27 0.3
28 0.29
29 0.31
30 0.3
31 0.31
32 0.37
33 0.37
34 0.39
35 0.4
36 0.39
37 0.41
38 0.41
39 0.37
40 0.31
41 0.28
42 0.25
43 0.27
44 0.25
45 0.21
46 0.2
47 0.19
48 0.19
49 0.19
50 0.18
51 0.14
52 0.13
53 0.13
54 0.15
55 0.16
56 0.15
57 0.18
58 0.22
59 0.25
60 0.29
61 0.3
62 0.34
63 0.38
64 0.43
65 0.41
66 0.42
67 0.43
68 0.46
69 0.54
70 0.53
71 0.52
72 0.52
73 0.53
74 0.51
75 0.49
76 0.42
77 0.36
78 0.31
79 0.28
80 0.24
81 0.21
82 0.23
83 0.21
84 0.2
85 0.24
86 0.29
87 0.28
88 0.26
89 0.26
90 0.23
91 0.29
92 0.32
93 0.35
94 0.38
95 0.48
96 0.54
97 0.62
98 0.66
99 0.71
100 0.76
101 0.74
102 0.74
103 0.7
104 0.65
105 0.59
106 0.59
107 0.54
108 0.47
109 0.4
110 0.35
111 0.31
112 0.3
113 0.29
114 0.27
115 0.23
116 0.22
117 0.23
118 0.21
119 0.22
120 0.19
121 0.18
122 0.19
123 0.2
124 0.2
125 0.2
126 0.19
127 0.18
128 0.24
129 0.28
130 0.33
131 0.38
132 0.47
133 0.5
134 0.56
135 0.61
136 0.65
137 0.71
138 0.73
139 0.75
140 0.71
141 0.68
142 0.62
143 0.59
144 0.54
145 0.45
146 0.4
147 0.32
148 0.27
149 0.26
150 0.26
151 0.24
152 0.21
153 0.21
154 0.16
155 0.15
156 0.17
157 0.19
158 0.21
159 0.21
160 0.18
161 0.18
162 0.18
163 0.17
164 0.15
165 0.13
166 0.13
167 0.15
168 0.14
169 0.14
170 0.13
171 0.13
172 0.13
173 0.12
174 0.08
175 0.11
176 0.13
177 0.15
178 0.15
179 0.15
180 0.14
181 0.18
182 0.24
183 0.23
184 0.25
185 0.25
186 0.27
187 0.27
188 0.28
189 0.25
190 0.25
191 0.26
192 0.23
193 0.22
194 0.25
195 0.25
196 0.27
197 0.31
198 0.27
199 0.24
200 0.25
201 0.24
202 0.19
203 0.19
204 0.16
205 0.13
206 0.11
207 0.09
208 0.08
209 0.08
210 0.07
211 0.08
212 0.07
213 0.06
214 0.06
215 0.07
216 0.06
217 0.07
218 0.09
219 0.09
220 0.11
221 0.11
222 0.12
223 0.12
224 0.13
225 0.12
226 0.1
227 0.09
228 0.08
229 0.07
230 0.05
231 0.04
232 0.03
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.05
239 0.06
240 0.06
241 0.06
242 0.06
243 0.05
244 0.06
245 0.05
246 0.05
247 0.05
248 0.04
249 0.04
250 0.05
251 0.06
252 0.05
253 0.05
254 0.06
255 0.06
256 0.07
257 0.08
258 0.07
259 0.07
260 0.08
261 0.09
262 0.09
263 0.09
264 0.09
265 0.08
266 0.08
267 0.07
268 0.07
269 0.07
270 0.07
271 0.07
272 0.07
273 0.11
274 0.12
275 0.14
276 0.17
277 0.16
278 0.15
279 0.16
280 0.2
281 0.18
282 0.23
283 0.28
284 0.36
285 0.45
286 0.52
287 0.55
288 0.58
289 0.63
290 0.65
291 0.69
292 0.69
293 0.72
294 0.76
295 0.83
296 0.84
297 0.86
298 0.9
299 0.89
300 0.88
301 0.87
302 0.86
303 0.86
304 0.84
305 0.8
306 0.8
307 0.72
308 0.68
309 0.65
310 0.57
311 0.46
312 0.48
313 0.45
314 0.36
315 0.36
316 0.32