Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SDC0

Protein Details
Accession M7SDC0    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
130-152LAAYRIPKNRRPHFRTGDRWKIYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 11.5, nucl 9.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020058  Glu/Gln-tRNA-synth_Ib_cat-dom  
IPR020059  Glu/Gln-tRNA-synth_Ib_codon-bd  
IPR020056  Rbsml_L25/Gln-tRNA_synth_N  
IPR011035  Ribosomal_L25/Gln-tRNA_synth  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0004812  F:aminoacyl-tRNA ligase activity  
GO:0005524  F:ATP binding  
GO:0006418  P:tRNA aminoacylation for protein translation  
KEGG ela:UCREL1_10907  -  
Pfam View protein in Pfam  
PF00749  tRNA-synt_1c  
PF03950  tRNA-synt_1c_C  
Amino Acid Sequences MVAKQFDDTNPDAEEGKYFDAIEEVIRWLGFTPHAITYTSDNFQALYNLAEKLIELGKAYVCHCNEGEIKLQRGGEEGSSPRYRCNHAAQVVETNLQKFRDMRDGKYEPQTAFLRMKQDITSNNTQMWDLAAYRIPKNRRPHFRTGDRWKIYPTESYEWLNKTLGVYEPMQREYGRLNISGTVMSKRALRTLVNEGHVRNWDDPRLYTLTAIRRRGVPPGAVLSFINELGVTTSQTLIQTSRFEQSIRRYLEVTVPRLMLVLDPVPLVIEDIGGLEGQQLDIPFFPKNPAIGSRKLTLTKTVFIDRSDFREVDSKDYFRLAPGKTVGLLHIPYPVTATTFEKDETTGLVTGIKAVFAKEGKKPKTYIQWVSQGSQNIETRIHSPLFKSPNPAAADGGFLSDINPESETIYPEALVESGLEEMRRQGPWPKAEGENIEAGPESVRFQAVRIAYFAVDSDSTENKTVLNRIVSLKEDPGKDVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.19
3 0.19
4 0.17
5 0.16
6 0.14
7 0.14
8 0.14
9 0.13
10 0.12
11 0.11
12 0.11
13 0.11
14 0.11
15 0.11
16 0.13
17 0.12
18 0.13
19 0.15
20 0.16
21 0.17
22 0.18
23 0.19
24 0.22
25 0.26
26 0.26
27 0.23
28 0.22
29 0.21
30 0.2
31 0.2
32 0.16
33 0.13
34 0.13
35 0.12
36 0.12
37 0.12
38 0.11
39 0.12
40 0.13
41 0.11
42 0.1
43 0.11
44 0.13
45 0.16
46 0.17
47 0.22
48 0.21
49 0.24
50 0.23
51 0.26
52 0.27
53 0.27
54 0.34
55 0.32
56 0.34
57 0.34
58 0.34
59 0.3
60 0.29
61 0.28
62 0.21
63 0.2
64 0.2
65 0.23
66 0.29
67 0.29
68 0.32
69 0.35
70 0.38
71 0.39
72 0.44
73 0.46
74 0.45
75 0.48
76 0.45
77 0.47
78 0.44
79 0.42
80 0.36
81 0.29
82 0.28
83 0.25
84 0.25
85 0.21
86 0.22
87 0.29
88 0.31
89 0.32
90 0.39
91 0.43
92 0.45
93 0.52
94 0.53
95 0.43
96 0.46
97 0.44
98 0.39
99 0.38
100 0.36
101 0.33
102 0.3
103 0.32
104 0.27
105 0.29
106 0.3
107 0.33
108 0.37
109 0.34
110 0.34
111 0.33
112 0.31
113 0.27
114 0.23
115 0.17
116 0.11
117 0.11
118 0.13
119 0.15
120 0.19
121 0.25
122 0.3
123 0.36
124 0.46
125 0.54
126 0.61
127 0.66
128 0.73
129 0.76
130 0.8
131 0.83
132 0.83
133 0.85
134 0.77
135 0.71
136 0.62
137 0.56
138 0.49
139 0.43
140 0.39
141 0.32
142 0.31
143 0.33
144 0.35
145 0.33
146 0.33
147 0.28
148 0.22
149 0.19
150 0.17
151 0.15
152 0.14
153 0.14
154 0.17
155 0.19
156 0.2
157 0.21
158 0.2
159 0.2
160 0.19
161 0.22
162 0.19
163 0.17
164 0.16
165 0.16
166 0.16
167 0.16
168 0.16
169 0.13
170 0.12
171 0.12
172 0.14
173 0.13
174 0.15
175 0.15
176 0.15
177 0.17
178 0.23
179 0.26
180 0.27
181 0.29
182 0.27
183 0.28
184 0.3
185 0.28
186 0.23
187 0.22
188 0.21
189 0.2
190 0.19
191 0.21
192 0.21
193 0.19
194 0.17
195 0.19
196 0.26
197 0.31
198 0.33
199 0.3
200 0.31
201 0.31
202 0.34
203 0.32
204 0.24
205 0.19
206 0.2
207 0.2
208 0.17
209 0.16
210 0.13
211 0.12
212 0.11
213 0.1
214 0.06
215 0.06
216 0.06
217 0.06
218 0.05
219 0.05
220 0.05
221 0.06
222 0.06
223 0.07
224 0.06
225 0.08
226 0.09
227 0.1
228 0.11
229 0.11
230 0.12
231 0.15
232 0.2
233 0.26
234 0.27
235 0.27
236 0.26
237 0.26
238 0.33
239 0.33
240 0.3
241 0.24
242 0.22
243 0.21
244 0.2
245 0.19
246 0.12
247 0.09
248 0.07
249 0.06
250 0.05
251 0.05
252 0.05
253 0.05
254 0.05
255 0.04
256 0.03
257 0.03
258 0.03
259 0.03
260 0.03
261 0.03
262 0.03
263 0.03
264 0.03
265 0.04
266 0.04
267 0.04
268 0.05
269 0.06
270 0.06
271 0.07
272 0.09
273 0.09
274 0.1
275 0.11
276 0.17
277 0.2
278 0.24
279 0.27
280 0.28
281 0.3
282 0.32
283 0.31
284 0.31
285 0.3
286 0.29
287 0.28
288 0.3
289 0.28
290 0.26
291 0.29
292 0.24
293 0.27
294 0.28
295 0.25
296 0.22
297 0.28
298 0.28
299 0.3
300 0.32
301 0.28
302 0.25
303 0.27
304 0.25
305 0.2
306 0.25
307 0.2
308 0.2
309 0.2
310 0.2
311 0.19
312 0.2
313 0.18
314 0.15
315 0.15
316 0.11
317 0.14
318 0.13
319 0.12
320 0.13
321 0.13
322 0.11
323 0.12
324 0.15
325 0.12
326 0.14
327 0.14
328 0.13
329 0.14
330 0.13
331 0.12
332 0.11
333 0.11
334 0.09
335 0.1
336 0.09
337 0.1
338 0.1
339 0.1
340 0.08
341 0.08
342 0.11
343 0.12
344 0.15
345 0.21
346 0.31
347 0.34
348 0.39
349 0.41
350 0.44
351 0.52
352 0.58
353 0.58
354 0.54
355 0.59
356 0.57
357 0.57
358 0.54
359 0.48
360 0.41
361 0.4
362 0.35
363 0.28
364 0.27
365 0.26
366 0.24
367 0.24
368 0.24
369 0.2
370 0.2
371 0.26
372 0.32
373 0.32
374 0.37
375 0.34
376 0.4
377 0.41
378 0.4
379 0.34
380 0.27
381 0.27
382 0.2
383 0.2
384 0.13
385 0.1
386 0.09
387 0.09
388 0.1
389 0.09
390 0.09
391 0.09
392 0.11
393 0.12
394 0.14
395 0.14
396 0.13
397 0.12
398 0.12
399 0.12
400 0.1
401 0.09
402 0.07
403 0.06
404 0.07
405 0.08
406 0.08
407 0.08
408 0.11
409 0.14
410 0.15
411 0.16
412 0.23
413 0.3
414 0.34
415 0.38
416 0.39
417 0.4
418 0.43
419 0.45
420 0.4
421 0.37
422 0.32
423 0.29
424 0.24
425 0.21
426 0.18
427 0.15
428 0.14
429 0.1
430 0.12
431 0.11
432 0.12
433 0.18
434 0.19
435 0.19
436 0.19
437 0.2
438 0.18
439 0.18
440 0.18
441 0.14
442 0.13
443 0.13
444 0.15
445 0.16
446 0.19
447 0.2
448 0.2
449 0.19
450 0.22
451 0.24
452 0.26
453 0.26
454 0.27
455 0.29
456 0.33
457 0.35
458 0.35
459 0.38
460 0.39
461 0.37