FuNGI

M7SDC0

Protein Details

Accession

M7SDC0

Localization Confidence

Low

Confidence Score

7.5

NoLS Segment(s)

Position	Sequence	Protein Nature
130-152	LAAYRIPKNRRPHFRTGDRWKIY	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

cyto 12.5, cyto_nucl 11.5, nucl 9.5, pero 5

Family & Domain DBs

InterPro	View protein in InterPro IPR020058 Glu/Gln-tRNA-synth_Ib_cat-dom IPR020059 Glu/Gln-tRNA-synth_Ib_codon-bd IPR020056 Rbsml_L25/Gln-tRNA_synth_N IPR011035 Ribosomal_L25/Gln-tRNA_synth IPR014729 Rossmann-like_a/b/a_fold
Gene Ontology	GO:0005737 C:cytoplasm GO:0004812 F:aminoacyl-tRNA ligase activity GO:0005524 F:ATP binding GO:0006418 P:tRNA aminoacylation for protein translation
KEGG	ela:UCREL1_10907 -
Pfam	View protein in Pfam PF00749 tRNA-synt_1c PF03950 tRNA-synt_1c_C

Amino Acid Sequences

MVAKQFDDTNPDAEEGKYFDAIEEVIRWLGFTPHAITYTSDNFQALYNLAEKLIELGKAYVCHCNEGEIKLQRGGEEGSSPRYRCNHAAQVVETNLQKFRDMRDGKYEPQTAFLRMKQDITSNNTQMWDLAAYRIPKNRRPHFRTGDRWKIYPTESYEWLNKTLGVYEPMQREYGRLNISGTVMSKRALRTLVNEGHVRNWDDPRLYTLTAIRRRGVPPGAVLSFINELGVTTSQTLIQTSRFEQSIRRYLEVTVPRLMLVLDPVPLVIEDIGGLEGQQLDIPFFPKNPAIGSRKLTLTKTVFIDRSDFREVDSKDYFRLAPGKTVGLLHIPYPVTATTFEKDETTGLVTGIKAVFAKEGKKPKTYIQWVSQGSQNIETRIHSPLFKSPNPAAADGGFLSDINPESETIYPEALVESGLEEMRRQGPWPKAEGENIEAGPESVRFQAVRIAYFAVDSDSTENKTVLNRIVSLKEDPGKDVG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.23
2	0.19
3	0.19
4	0.17
5	0.16
6	0.14
7	0.14
8	0.14
9	0.13
10	0.12
11	0.11
12	0.11
13	0.11
14	0.11
15	0.11
16	0.13
17	0.12
18	0.13
19	0.15
20	0.16
21	0.17
22	0.18
23	0.19
24	0.22
25	0.26
26	0.26
27	0.23
28	0.22
29	0.21
30	0.2
31	0.2
32	0.16
33	0.13
34	0.13
35	0.12
36	0.12
37	0.12
38	0.11
39	0.12
40	0.13
41	0.11
42	0.1
43	0.11
44	0.13
45	0.16
46	0.17
47	0.22
48	0.21
49	0.24
50	0.23
51	0.26
52	0.27
53	0.27
54	0.34
55	0.32
56	0.34
57	0.34
58	0.34
59	0.3
60	0.29
61	0.28
62	0.21
63	0.2
64	0.2
65	0.23
66	0.29
67	0.29
68	0.32
69	0.35
70	0.38
71	0.39
72	0.44
73	0.46
74	0.45
75	0.48
76	0.45
77	0.47
78	0.44
79	0.42
80	0.36
81	0.29
82	0.28
83	0.25
84	0.25
85	0.21
86	0.22
87	0.29
88	0.31
89	0.32
90	0.39
91	0.43
92	0.45
93	0.52
94	0.53
95	0.43
96	0.46
97	0.44
98	0.39
99	0.38
100	0.36
101	0.33
102	0.3
103	0.32
104	0.27
105	0.29
106	0.3
107	0.33
108	0.37
109	0.34
110	0.34
111	0.33
112	0.31
113	0.27
114	0.23
115	0.17
116	0.11
117	0.11
118	0.13
119	0.15
120	0.19
121	0.25
122	0.3
123	0.36
124	0.46
125	0.54
126	0.61
127	0.66
128	0.73
129	0.76
130	0.8
131	0.83
132	0.83
133	0.85
134	0.77
135	0.71
136	0.62
137	0.56
138	0.49
139	0.43
140	0.39
141	0.32
142	0.31
143	0.33
144	0.35
145	0.33
146	0.33
147	0.28
148	0.22
149	0.19
150	0.17
151	0.15
152	0.14
153	0.14
154	0.17
155	0.19
156	0.2
157	0.21
158	0.2
159	0.2
160	0.19
161	0.22
162	0.19
163	0.17
164	0.16
165	0.16
166	0.16
167	0.16
168	0.16
169	0.13
170	0.12
171	0.12
172	0.14
173	0.13
174	0.15
175	0.15
176	0.15
177	0.17
178	0.23
179	0.26
180	0.27
181	0.29
182	0.27
183	0.28
184	0.3
185	0.28
186	0.23
187	0.22
188	0.21
189	0.2
190	0.19
191	0.21
192	0.21
193	0.19
194	0.17
195	0.19
196	0.26
197	0.31
198	0.33
199	0.3
200	0.31
201	0.31
202	0.34
203	0.32
204	0.24
205	0.19
206	0.2
207	0.2
208	0.17
209	0.16
210	0.13
211	0.12
212	0.11
213	0.1
214	0.06
215	0.06
216	0.06
217	0.06
218	0.05
219	0.05
220	0.05
221	0.06
222	0.06
223	0.07
224	0.06
225	0.08
226	0.09
227	0.1
228	0.11
229	0.11
230	0.12
231	0.15
232	0.2
233	0.26
234	0.27
235	0.27
236	0.26
237	0.26
238	0.33
239	0.33
240	0.3
241	0.24
242	0.22
243	0.21
244	0.2
245	0.19
246	0.12
247	0.09
248	0.07
249	0.06
250	0.05
251	0.05
252	0.05
253	0.05
254	0.05
255	0.04
256	0.03
257	0.03
258	0.03
259	0.03
260	0.03
261	0.03
262	0.03
263	0.03
264	0.03
265	0.04
266	0.04
267	0.04
268	0.05
269	0.06
270	0.06
271	0.07
272	0.09
273	0.09
274	0.1
275	0.11
276	0.17
277	0.2
278	0.24
279	0.27
280	0.28
281	0.3
282	0.32
283	0.31
284	0.31
285	0.3
286	0.29
287	0.28
288	0.3
289	0.28
290	0.26
291	0.29
292	0.24
293	0.27
294	0.28
295	0.25
296	0.22
297	0.28
298	0.28
299	0.3
300	0.32
301	0.28
302	0.25
303	0.27
304	0.25
305	0.2
306	0.25
307	0.2
308	0.2
309	0.2
310	0.2
311	0.19
312	0.2
313	0.18
314	0.15
315	0.15
316	0.11
317	0.14
318	0.13
319	0.12
320	0.13
321	0.13
322	0.11
323	0.12
324	0.15
325	0.12
326	0.14
327	0.14
328	0.13
329	0.14
330	0.13
331	0.12
332	0.11
333	0.11
334	0.09
335	0.1
336	0.09
337	0.1
338	0.1
339	0.1
340	0.08
341	0.08
342	0.11
343	0.12
344	0.15
345	0.21
346	0.31
347	0.34
348	0.39
349	0.41
350	0.44
351	0.52
352	0.58
353	0.58
354	0.54
355	0.59
356	0.57
357	0.57
358	0.54
359	0.48
360	0.41
361	0.4
362	0.35
363	0.28
364	0.27
365	0.26
366	0.24
367	0.24
368	0.24
369	0.2
370	0.2
371	0.26
372	0.32
373	0.32
374	0.37
375	0.34
376	0.4
377	0.41
378	0.4
379	0.34
380	0.27
381	0.27
382	0.2
383	0.2
384	0.13
385	0.1
386	0.09
387	0.09
388	0.1
389	0.09
390	0.09
391	0.09
392	0.11
393	0.12
394	0.14
395	0.14
396	0.13
397	0.12
398	0.12
399	0.12
400	0.1
401	0.09
402	0.07
403	0.06
404	0.07
405	0.08
406	0.08
407	0.08
408	0.11
409	0.14
410	0.15
411	0.16
412	0.23
413	0.3
414	0.34
415	0.38
416	0.39
417	0.4
418	0.43
419	0.45
420	0.4
421	0.37
422	0.32
423	0.29
424	0.24
425	0.21
426	0.18
427	0.15
428	0.14
429	0.1
430	0.12
431	0.11
432	0.12
433	0.18
434	0.19
435	0.19
436	0.19
437	0.2
438	0.18
439	0.18
440	0.18
441	0.14
442	0.13
443	0.13
444	0.15
445	0.16
446	0.19
447	0.2
448	0.2
449	0.19
450	0.22
451	0.24
452	0.26
453	0.26
454	0.27
455	0.29
456	0.33
457	0.35
458	0.35
459	0.38
460	0.39
461	0.37

M7SDC0

3D AlphaFold-predicted Structure Viewer