Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7T3M3

Protein Details
Accession M7T3M3    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
172-193EGEKKWKWKDVTARRRKMSRGABasic
NLS Segment(s)
PositionSequence
164-200KEKGEKKGEGEKKWKWKDVTARRRKMSRGAPVRHHGP
Subcellular Location(s) nucl 18.5, cyto_nucl 13.333, mito_nucl 11.166, cyto 6
Family & Domain DBs
KEGG ela:UCREL1_1802  -  
Amino Acid Sequences MEKYQQQQQEEEEEEDIKGKRLPAMGTIRQSPTEPPPPPSHAPSHARLYFVPKETVAYYEPPSLLSQNSPRLRHAVSSPSVGSNDTKNLTTTATTSPSIAVPGRRRERLVGTGIDVQEMIRQANERGGSVRYVTDDELLKRRGGVVVGGSGQRIVVPVEKEDEKEKGEKKGEGEKKWKWKDVTARRRKMSRGAPVRHHGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.25
4 0.2
5 0.19
6 0.18
7 0.19
8 0.21
9 0.21
10 0.25
11 0.33
12 0.37
13 0.39
14 0.43
15 0.42
16 0.41
17 0.41
18 0.37
19 0.36
20 0.39
21 0.37
22 0.37
23 0.4
24 0.45
25 0.48
26 0.49
27 0.47
28 0.45
29 0.48
30 0.48
31 0.51
32 0.46
33 0.43
34 0.4
35 0.42
36 0.4
37 0.38
38 0.35
39 0.26
40 0.27
41 0.25
42 0.27
43 0.21
44 0.18
45 0.18
46 0.19
47 0.18
48 0.18
49 0.18
50 0.17
51 0.16
52 0.16
53 0.18
54 0.25
55 0.31
56 0.31
57 0.32
58 0.34
59 0.34
60 0.32
61 0.3
62 0.27
63 0.23
64 0.24
65 0.23
66 0.21
67 0.21
68 0.2
69 0.18
70 0.14
71 0.14
72 0.13
73 0.13
74 0.12
75 0.12
76 0.12
77 0.11
78 0.12
79 0.11
80 0.13
81 0.12
82 0.12
83 0.12
84 0.11
85 0.12
86 0.11
87 0.14
88 0.16
89 0.25
90 0.29
91 0.3
92 0.31
93 0.32
94 0.35
95 0.34
96 0.32
97 0.24
98 0.22
99 0.24
100 0.23
101 0.21
102 0.17
103 0.14
104 0.12
105 0.12
106 0.09
107 0.06
108 0.07
109 0.07
110 0.1
111 0.11
112 0.1
113 0.11
114 0.12
115 0.12
116 0.12
117 0.12
118 0.1
119 0.11
120 0.11
121 0.12
122 0.13
123 0.15
124 0.2
125 0.21
126 0.2
127 0.18
128 0.19
129 0.17
130 0.15
131 0.14
132 0.09
133 0.1
134 0.11
135 0.12
136 0.11
137 0.1
138 0.09
139 0.08
140 0.08
141 0.07
142 0.09
143 0.1
144 0.11
145 0.16
146 0.17
147 0.19
148 0.21
149 0.23
150 0.23
151 0.29
152 0.31
153 0.35
154 0.38
155 0.39
156 0.41
157 0.49
158 0.54
159 0.56
160 0.62
161 0.62
162 0.69
163 0.74
164 0.78
165 0.7
166 0.7
167 0.73
168 0.75
169 0.77
170 0.77
171 0.79
172 0.8
173 0.84
174 0.8
175 0.79
176 0.77
177 0.77
178 0.76
179 0.74
180 0.75