Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S6S2

Protein Details
Accession F4S6S2    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
129-157SKPVVSSKTRQRKKAKANARRKANAKRGVHydrophilic
NLS Segment(s)
PositionSequence
136-155KTRQRKKAKANARRKANAKR
216-223RKSKRRKA
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 5
Family & Domain DBs
KEGG mlr:MELLADRAFT_68423  -  
Amino Acid Sequences MQKATKLFRLQKLFREIRLERSSIKNYDEHFDSFRQFHDEYGRPGSESDQTGPEPDIKGDAFSSAKELVAAMDTITWEEINNILISQTDEDEVPKVNKSQSQSNTDNQNKAPNRKALIKDLEDETANESKPVVSSKTRQRKKAKANARRKANAKRGVAEEEATAESTPGSLLRCATVGSKKGSGWKGWELVAIDNLLTEVKTEVISPESAVSGTVRKSKRRKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.65
3 0.59
4 0.58
5 0.59
6 0.53
7 0.47
8 0.5
9 0.52
10 0.46
11 0.47
12 0.42
13 0.39
14 0.42
15 0.4
16 0.36
17 0.33
18 0.32
19 0.33
20 0.29
21 0.28
22 0.29
23 0.25
24 0.25
25 0.29
26 0.3
27 0.3
28 0.35
29 0.34
30 0.29
31 0.29
32 0.29
33 0.26
34 0.25
35 0.23
36 0.2
37 0.2
38 0.2
39 0.21
40 0.21
41 0.18
42 0.15
43 0.16
44 0.13
45 0.13
46 0.12
47 0.13
48 0.11
49 0.1
50 0.13
51 0.11
52 0.11
53 0.1
54 0.1
55 0.08
56 0.08
57 0.08
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.04
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.07
79 0.08
80 0.09
81 0.09
82 0.1
83 0.11
84 0.14
85 0.16
86 0.23
87 0.27
88 0.33
89 0.35
90 0.38
91 0.47
92 0.47
93 0.47
94 0.4
95 0.44
96 0.4
97 0.42
98 0.42
99 0.36
100 0.36
101 0.4
102 0.41
103 0.38
104 0.4
105 0.36
106 0.34
107 0.32
108 0.3
109 0.24
110 0.22
111 0.19
112 0.16
113 0.14
114 0.12
115 0.11
116 0.1
117 0.1
118 0.11
119 0.11
120 0.12
121 0.19
122 0.29
123 0.4
124 0.46
125 0.55
126 0.63
127 0.7
128 0.77
129 0.81
130 0.82
131 0.82
132 0.87
133 0.86
134 0.86
135 0.84
136 0.82
137 0.82
138 0.81
139 0.78
140 0.7
141 0.65
142 0.59
143 0.56
144 0.49
145 0.4
146 0.3
147 0.23
148 0.21
149 0.17
150 0.14
151 0.1
152 0.08
153 0.07
154 0.07
155 0.06
156 0.07
157 0.07
158 0.07
159 0.08
160 0.08
161 0.09
162 0.13
163 0.17
164 0.2
165 0.23
166 0.25
167 0.25
168 0.33
169 0.35
170 0.34
171 0.34
172 0.35
173 0.33
174 0.31
175 0.33
176 0.27
177 0.25
178 0.24
179 0.19
180 0.14
181 0.12
182 0.11
183 0.09
184 0.07
185 0.07
186 0.06
187 0.06
188 0.07
189 0.07
190 0.08
191 0.1
192 0.11
193 0.11
194 0.11
195 0.11
196 0.11
197 0.11
198 0.11
199 0.13
200 0.16
201 0.24
202 0.29
203 0.38