Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7TP71

Protein Details
Accession M7TP71    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
201-235LAISVRRQRKLKMKKKKYKKLMKRTRNERRKLDRVBasic
NLS Segment(s)
PositionSequence
191-234QRRRRVPGGMLAISVRRQRKLKMKKKKYKKLMKRTRNERRKLDR
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
KEGG ela:UCREL1_4470  -  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MSVTHSFPKTVTDDIFAQIFTPLTKDNKVDDVISTLSHTVDQLEDPMRSLSLETQQDGGVVATDANGEHMKIEVRHADGSESNVYVQLNAMAGQFLPFRPPPAPQPESATEKAAREDMAAAAAAAAETPAEALETRIYKAMFTLEETVDANGETRIVAHSPELVEENDGAVPRTFLERMALREIRREEAQQRRRRVPGGMLAISVRRQRKLKMKKKKYKKLMKRTRNERRKLDRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.21
4 0.18
5 0.15
6 0.14
7 0.11
8 0.11
9 0.13
10 0.16
11 0.2
12 0.21
13 0.23
14 0.27
15 0.28
16 0.27
17 0.24
18 0.23
19 0.21
20 0.19
21 0.18
22 0.14
23 0.13
24 0.12
25 0.12
26 0.09
27 0.09
28 0.09
29 0.11
30 0.12
31 0.12
32 0.13
33 0.14
34 0.13
35 0.12
36 0.13
37 0.12
38 0.16
39 0.18
40 0.18
41 0.18
42 0.18
43 0.18
44 0.17
45 0.15
46 0.08
47 0.07
48 0.06
49 0.04
50 0.05
51 0.04
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.08
58 0.09
59 0.11
60 0.11
61 0.13
62 0.14
63 0.14
64 0.16
65 0.14
66 0.17
67 0.16
68 0.14
69 0.12
70 0.13
71 0.12
72 0.1
73 0.1
74 0.07
75 0.06
76 0.06
77 0.06
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.09
84 0.08
85 0.1
86 0.11
87 0.13
88 0.17
89 0.25
90 0.27
91 0.24
92 0.29
93 0.31
94 0.36
95 0.36
96 0.34
97 0.27
98 0.25
99 0.25
100 0.21
101 0.17
102 0.11
103 0.11
104 0.08
105 0.06
106 0.06
107 0.05
108 0.04
109 0.04
110 0.03
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.03
120 0.06
121 0.06
122 0.07
123 0.09
124 0.09
125 0.09
126 0.09
127 0.1
128 0.09
129 0.1
130 0.12
131 0.1
132 0.11
133 0.12
134 0.11
135 0.1
136 0.1
137 0.08
138 0.06
139 0.06
140 0.04
141 0.04
142 0.05
143 0.05
144 0.06
145 0.06
146 0.07
147 0.07
148 0.08
149 0.1
150 0.09
151 0.1
152 0.09
153 0.1
154 0.09
155 0.09
156 0.1
157 0.08
158 0.08
159 0.08
160 0.1
161 0.1
162 0.09
163 0.13
164 0.15
165 0.18
166 0.25
167 0.29
168 0.27
169 0.34
170 0.36
171 0.36
172 0.36
173 0.37
174 0.39
175 0.46
176 0.55
177 0.57
178 0.63
179 0.66
180 0.69
181 0.67
182 0.62
183 0.56
184 0.55
185 0.53
186 0.46
187 0.39
188 0.36
189 0.35
190 0.36
191 0.37
192 0.33
193 0.32
194 0.34
195 0.41
196 0.51
197 0.6
198 0.66
199 0.71
200 0.79
201 0.84
202 0.92
203 0.95
204 0.95
205 0.95
206 0.96
207 0.96
208 0.96
209 0.95
210 0.95
211 0.95
212 0.96
213 0.95
214 0.94
215 0.93