Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SXE1

Protein Details
Accession M7SXE1   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
195-218DATATKPKKEKKEKAPKQPKAPAAHydrophilic
NLS Segment(s)
PositionSequence
200-220KPKKEKKEKAPKQPKAPAAPA
Subcellular Location(s) cyto 15, cyto_nucl 12.5, nucl 6, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036282  Glutathione-S-Trfase_C_sf  
IPR004046  GST_C  
IPR012340  NA-bd_OB-fold  
IPR002547  tRNA-bd_dom  
Gene Ontology GO:0000049  F:tRNA binding  
KEGG ela:UCREL1_3778  -  
Pfam View protein in Pfam  
PF00043  GST_C  
PF01588  tRNA_bind  
PROSITE View protein in PROSITE  
PS50886  TRBD  
CDD cd10304  GST_C_Arc1p_N_like  
Amino Acid Sequences MPAAETQKKTSSSTSSTEEAEIQQWLTTSDRLKSDPSDASILEKLNAHLSSRTTLLGTKPSRADIAIYEALAPAVKTWSAEQKTGQAGHPHVVRHLDFVQNAPPGVFDKTVASDADKIKVDPEEVLYVKPPVDAKAEKERLKKEKAAAAAAATGGSGGGGVAATVVDRTKAAAEAVKDAAVDAKDKVVAATTGADATATKPKKEKKEKAPKQPKAPAAPASPPSPRLIDLRVGHILKAIKHPEADSLYVSTIAMGDAPGTDDTEEYEGQTCRTVCSGLNGIVPLDEMQGRKVVVVANLKPVKMRGIKSCAMVLAASPRLKEGEVDDHKGPVELVTPPLDAKAGERVNFVGWEGEPEGVLNPKKKVWEMFQPGFTTTDDLEVAFDGRAVKEAGKEAVGKLVVTAGGGVCTVKTLKGATVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.39
3 0.38
4 0.37
5 0.34
6 0.3
7 0.26
8 0.23
9 0.19
10 0.16
11 0.15
12 0.15
13 0.15
14 0.17
15 0.18
16 0.21
17 0.24
18 0.26
19 0.29
20 0.3
21 0.33
22 0.33
23 0.33
24 0.32
25 0.29
26 0.31
27 0.31
28 0.29
29 0.25
30 0.23
31 0.21
32 0.23
33 0.23
34 0.21
35 0.2
36 0.21
37 0.22
38 0.22
39 0.22
40 0.17
41 0.19
42 0.2
43 0.27
44 0.27
45 0.3
46 0.31
47 0.32
48 0.32
49 0.3
50 0.29
51 0.21
52 0.25
53 0.21
54 0.19
55 0.18
56 0.17
57 0.16
58 0.15
59 0.13
60 0.07
61 0.07
62 0.07
63 0.08
64 0.1
65 0.19
66 0.22
67 0.24
68 0.25
69 0.28
70 0.33
71 0.34
72 0.35
73 0.31
74 0.3
75 0.33
76 0.35
77 0.3
78 0.28
79 0.3
80 0.27
81 0.26
82 0.27
83 0.26
84 0.23
85 0.24
86 0.27
87 0.23
88 0.23
89 0.19
90 0.17
91 0.15
92 0.17
93 0.15
94 0.11
95 0.12
96 0.13
97 0.15
98 0.15
99 0.14
100 0.18
101 0.19
102 0.22
103 0.21
104 0.19
105 0.2
106 0.2
107 0.19
108 0.14
109 0.15
110 0.15
111 0.15
112 0.16
113 0.15
114 0.15
115 0.15
116 0.16
117 0.14
118 0.12
119 0.16
120 0.17
121 0.21
122 0.31
123 0.38
124 0.43
125 0.49
126 0.55
127 0.57
128 0.62
129 0.61
130 0.55
131 0.52
132 0.49
133 0.44
134 0.36
135 0.3
136 0.24
137 0.19
138 0.15
139 0.1
140 0.07
141 0.04
142 0.04
143 0.03
144 0.02
145 0.02
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.03
152 0.03
153 0.03
154 0.03
155 0.04
156 0.04
157 0.05
158 0.06
159 0.08
160 0.08
161 0.1
162 0.11
163 0.11
164 0.1
165 0.1
166 0.11
167 0.09
168 0.09
169 0.07
170 0.07
171 0.07
172 0.07
173 0.07
174 0.06
175 0.06
176 0.05
177 0.06
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.06
184 0.14
185 0.14
186 0.15
187 0.2
188 0.27
189 0.37
190 0.48
191 0.56
192 0.59
193 0.7
194 0.78
195 0.84
196 0.9
197 0.86
198 0.85
199 0.83
200 0.77
201 0.71
202 0.65
203 0.58
204 0.49
205 0.46
206 0.39
207 0.34
208 0.3
209 0.26
210 0.24
211 0.21
212 0.19
213 0.18
214 0.17
215 0.2
216 0.2
217 0.22
218 0.25
219 0.24
220 0.23
221 0.24
222 0.24
223 0.19
224 0.24
225 0.23
226 0.19
227 0.2
228 0.2
229 0.21
230 0.21
231 0.2
232 0.15
233 0.14
234 0.13
235 0.13
236 0.12
237 0.09
238 0.07
239 0.05
240 0.05
241 0.04
242 0.03
243 0.03
244 0.04
245 0.05
246 0.05
247 0.05
248 0.05
249 0.06
250 0.08
251 0.08
252 0.08
253 0.1
254 0.1
255 0.11
256 0.13
257 0.13
258 0.11
259 0.12
260 0.12
261 0.1
262 0.13
263 0.15
264 0.14
265 0.15
266 0.14
267 0.13
268 0.12
269 0.12
270 0.09
271 0.08
272 0.09
273 0.08
274 0.09
275 0.1
276 0.1
277 0.1
278 0.11
279 0.11
280 0.13
281 0.19
282 0.19
283 0.27
284 0.29
285 0.29
286 0.29
287 0.28
288 0.31
289 0.31
290 0.33
291 0.31
292 0.36
293 0.38
294 0.39
295 0.4
296 0.33
297 0.28
298 0.24
299 0.18
300 0.16
301 0.18
302 0.18
303 0.17
304 0.17
305 0.18
306 0.18
307 0.18
308 0.16
309 0.22
310 0.25
311 0.3
312 0.3
313 0.3
314 0.3
315 0.3
316 0.26
317 0.16
318 0.14
319 0.1
320 0.12
321 0.12
322 0.13
323 0.13
324 0.13
325 0.13
326 0.11
327 0.11
328 0.18
329 0.19
330 0.2
331 0.21
332 0.22
333 0.22
334 0.23
335 0.22
336 0.15
337 0.12
338 0.14
339 0.14
340 0.13
341 0.11
342 0.11
343 0.12
344 0.16
345 0.2
346 0.21
347 0.23
348 0.25
349 0.29
350 0.32
351 0.36
352 0.36
353 0.42
354 0.48
355 0.51
356 0.53
357 0.52
358 0.49
359 0.46
360 0.41
361 0.33
362 0.24
363 0.21
364 0.16
365 0.14
366 0.13
367 0.12
368 0.12
369 0.09
370 0.1
371 0.09
372 0.09
373 0.11
374 0.12
375 0.12
376 0.14
377 0.17
378 0.18
379 0.19
380 0.2
381 0.19
382 0.23
383 0.22
384 0.2
385 0.17
386 0.17
387 0.14
388 0.12
389 0.13
390 0.07
391 0.07
392 0.08
393 0.08
394 0.06
395 0.08
396 0.09
397 0.09
398 0.11
399 0.12