Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7T5G2

Protein Details
Accession M7T5G2    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
43-66VAAMNKKRWLERNNRNNQKRQEASHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, cyto_nucl 5.5, cyto 5, nucl 4, mito 1, pero 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR015889  Intradiol_dOase_core  
Gene Ontology GO:0005506  F:iron ion binding  
GO:0016702  F:oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen  
KEGG ela:UCREL1_1091  -  
CDD cd03457  intradiol_dioxygenase_like  
Amino Acid Sequences MHSSLLAIGAVLLSGAVAHSHSELSYSELVRRDGLSKRCESSVAAMNKKRWLERNNRNNQKRQEASSNTTTWNIVTEAPYYDVLQNNTCILTEETTSGPYVWPQSQTLRQDITEGQVGIPMILDIGVMDLESCEPLPDVLVDIWYCNATGSYSSFTGLNPNTPFEELLDQLNKTIGDDLHTDDTTFLRGMWPTNDEGVTEFTGIVPGFYVDRTIHIHVQVHENYVIRGNGTIASSTTLSTGQLFLAEDLSERLMALEPYSTHDDINRTTNDIDSIFAGESSNGWDPTLMVVPMDGENPENGIVGYITVGVDTATKKLKKRELLGEKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.04
5 0.05
6 0.06
7 0.07
8 0.07
9 0.08
10 0.09
11 0.13
12 0.16
13 0.17
14 0.2
15 0.23
16 0.24
17 0.24
18 0.26
19 0.26
20 0.3
21 0.36
22 0.38
23 0.4
24 0.42
25 0.41
26 0.41
27 0.38
28 0.35
29 0.37
30 0.39
31 0.43
32 0.45
33 0.48
34 0.53
35 0.56
36 0.56
37 0.55
38 0.56
39 0.58
40 0.63
41 0.71
42 0.76
43 0.83
44 0.86
45 0.87
46 0.86
47 0.85
48 0.79
49 0.74
50 0.72
51 0.68
52 0.66
53 0.62
54 0.57
55 0.48
56 0.44
57 0.39
58 0.29
59 0.24
60 0.19
61 0.14
62 0.13
63 0.13
64 0.13
65 0.14
66 0.15
67 0.15
68 0.16
69 0.18
70 0.18
71 0.18
72 0.18
73 0.17
74 0.16
75 0.15
76 0.14
77 0.12
78 0.12
79 0.11
80 0.12
81 0.12
82 0.12
83 0.13
84 0.11
85 0.1
86 0.1
87 0.12
88 0.12
89 0.14
90 0.15
91 0.19
92 0.25
93 0.28
94 0.3
95 0.28
96 0.27
97 0.27
98 0.26
99 0.24
100 0.2
101 0.17
102 0.13
103 0.13
104 0.13
105 0.1
106 0.09
107 0.07
108 0.04
109 0.04
110 0.04
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.04
124 0.04
125 0.05
126 0.04
127 0.05
128 0.05
129 0.05
130 0.06
131 0.06
132 0.06
133 0.05
134 0.05
135 0.04
136 0.05
137 0.06
138 0.07
139 0.08
140 0.08
141 0.08
142 0.08
143 0.12
144 0.12
145 0.15
146 0.13
147 0.14
148 0.15
149 0.15
150 0.15
151 0.11
152 0.12
153 0.09
154 0.11
155 0.11
156 0.1
157 0.1
158 0.11
159 0.1
160 0.09
161 0.09
162 0.07
163 0.08
164 0.09
165 0.1
166 0.12
167 0.12
168 0.12
169 0.11
170 0.12
171 0.11
172 0.1
173 0.08
174 0.06
175 0.07
176 0.08
177 0.09
178 0.1
179 0.1
180 0.11
181 0.11
182 0.1
183 0.11
184 0.12
185 0.11
186 0.1
187 0.09
188 0.07
189 0.09
190 0.08
191 0.07
192 0.05
193 0.05
194 0.05
195 0.05
196 0.07
197 0.05
198 0.08
199 0.11
200 0.14
201 0.15
202 0.17
203 0.2
204 0.19
205 0.25
206 0.24
207 0.23
208 0.22
209 0.21
210 0.2
211 0.2
212 0.18
213 0.13
214 0.12
215 0.1
216 0.1
217 0.1
218 0.1
219 0.08
220 0.09
221 0.09
222 0.09
223 0.1
224 0.08
225 0.08
226 0.09
227 0.09
228 0.07
229 0.08
230 0.08
231 0.07
232 0.07
233 0.07
234 0.07
235 0.07
236 0.08
237 0.07
238 0.06
239 0.07
240 0.07
241 0.07
242 0.07
243 0.08
244 0.08
245 0.12
246 0.17
247 0.17
248 0.17
249 0.19
250 0.21
251 0.22
252 0.27
253 0.24
254 0.22
255 0.22
256 0.23
257 0.22
258 0.2
259 0.18
260 0.13
261 0.14
262 0.11
263 0.1
264 0.1
265 0.08
266 0.08
267 0.11
268 0.14
269 0.12
270 0.12
271 0.12
272 0.12
273 0.15
274 0.17
275 0.13
276 0.09
277 0.09
278 0.11
279 0.11
280 0.12
281 0.1
282 0.09
283 0.09
284 0.1
285 0.1
286 0.09
287 0.08
288 0.08
289 0.07
290 0.07
291 0.07
292 0.06
293 0.06
294 0.05
295 0.05
296 0.05
297 0.07
298 0.08
299 0.12
300 0.2
301 0.25
302 0.31
303 0.41
304 0.49
305 0.56
306 0.63
307 0.7