Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SFA1

Protein Details
Accession M7SFA1   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
66-92DETQPKKVSVRRLRKARRKVTRTLKRMBasic
NLS Segment(s)
PositionSequence
51-54KRKR
71-90KKVSVRRLRKARRKVTRTLK
Subcellular Location(s) mito 18.5, mito_nucl 12.5, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR002156  RNaseH_domain  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0004523  F:RNA-DNA hybrid ribonuclease activity  
KEGG ela:UCREL1_8085  -  
PROSITE View protein in PROSITE  
PS50879  RNASE_H_1  
Amino Acid Sequences MVRKLNRLVSNGIQVHFHWTKGHSNGFGNNRADLLAGTASLDQSLKDLREKRKRKFGELDSAGEDDETQPKKVSVRRLRKARRKVTRTLKRMGVNTSAPRPAPQPEPTDAGDVPSGITEGAAVSTSVTDDAAINHCQQMLSQVTEEATGTEKAGETEKVEETEKVETEKVGETSVPDEPQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.33
4 0.31
5 0.24
6 0.24
7 0.3
8 0.33
9 0.37
10 0.32
11 0.33
12 0.4
13 0.43
14 0.47
15 0.42
16 0.37
17 0.33
18 0.3
19 0.27
20 0.2
21 0.16
22 0.09
23 0.07
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.06
30 0.07
31 0.09
32 0.1
33 0.16
34 0.24
35 0.33
36 0.44
37 0.53
38 0.6
39 0.68
40 0.71
41 0.72
42 0.75
43 0.7
44 0.7
45 0.65
46 0.6
47 0.51
48 0.47
49 0.39
50 0.3
51 0.24
52 0.14
53 0.17
54 0.15
55 0.14
56 0.14
57 0.15
58 0.19
59 0.22
60 0.32
61 0.36
62 0.45
63 0.54
64 0.64
65 0.74
66 0.8
67 0.87
68 0.87
69 0.87
70 0.82
71 0.82
72 0.83
73 0.82
74 0.78
75 0.72
76 0.68
77 0.61
78 0.58
79 0.51
80 0.43
81 0.37
82 0.34
83 0.32
84 0.28
85 0.24
86 0.23
87 0.22
88 0.21
89 0.21
90 0.22
91 0.23
92 0.24
93 0.27
94 0.27
95 0.28
96 0.25
97 0.22
98 0.18
99 0.15
100 0.12
101 0.09
102 0.08
103 0.05
104 0.05
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.06
118 0.09
119 0.1
120 0.11
121 0.11
122 0.12
123 0.11
124 0.11
125 0.14
126 0.14
127 0.14
128 0.14
129 0.14
130 0.14
131 0.14
132 0.15
133 0.11
134 0.11
135 0.09
136 0.09
137 0.09
138 0.09
139 0.1
140 0.12
141 0.12
142 0.12
143 0.14
144 0.16
145 0.17
146 0.19
147 0.19
148 0.19
149 0.22
150 0.21
151 0.21
152 0.2
153 0.18
154 0.18
155 0.21
156 0.19
157 0.17
158 0.16
159 0.15
160 0.17
161 0.21