Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7TJF8

Protein Details
Accession M7TJF8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-31ASKPKAPPTPKDPNAKRFNPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009163  Ap4A_phos1/2  
IPR043171  Ap4A_phos1/2-like  
IPR045759  Ap4A_phos1/2_N  
IPR019200  ATP_adenylylTrfase_C  
IPR036265  HIT-like_sf  
Gene Ontology GO:0003877  F:ATP adenylyltransferase activity  
GO:0005524  F:ATP binding  
GO:0009117  P:nucleotide metabolic process  
KEGG ela:UCREL1_6132  -  
Pfam View protein in Pfam  
PF19327  Ap4A_phos_N  
PF09830  ATP_transf  
Amino Acid Sequences MQFQLRYSPALASKPKAPPTPKDPNAKRFNPFEDPSPSLLVAQLPPAHRLVLNKFAVVPEHFILATKEVKPQTHVLEEDDIAAAYACVEAYAREGQELFVFFNSGEHSGASQPHRHLQLLPVARMKDGLEQVERGGSWSVLADKLGVLEQPLPFAVLTSATTPDMSVKARHEAYVDMYKRAVKAVSPEAEAPGEGKAKISYNFAMTRTSMAICPRTAEGAVIRNKMDVEVGQVALNGTLLAGTALVKSQAEWDALVENPGLLHGVLKEIGIKPQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.56
4 0.58
5 0.58
6 0.62
7 0.7
8 0.69
9 0.73
10 0.74
11 0.76
12 0.8
13 0.79
14 0.76
15 0.71
16 0.7
17 0.67
18 0.61
19 0.56
20 0.54
21 0.51
22 0.48
23 0.44
24 0.38
25 0.3
26 0.28
27 0.24
28 0.17
29 0.17
30 0.19
31 0.17
32 0.19
33 0.19
34 0.19
35 0.19
36 0.23
37 0.24
38 0.29
39 0.28
40 0.27
41 0.26
42 0.26
43 0.27
44 0.24
45 0.23
46 0.15
47 0.15
48 0.15
49 0.15
50 0.15
51 0.15
52 0.18
53 0.15
54 0.21
55 0.22
56 0.23
57 0.26
58 0.28
59 0.29
60 0.29
61 0.29
62 0.26
63 0.25
64 0.24
65 0.22
66 0.18
67 0.14
68 0.1
69 0.09
70 0.07
71 0.04
72 0.04
73 0.03
74 0.03
75 0.03
76 0.03
77 0.06
78 0.08
79 0.08
80 0.08
81 0.08
82 0.09
83 0.1
84 0.11
85 0.09
86 0.07
87 0.07
88 0.07
89 0.07
90 0.08
91 0.08
92 0.08
93 0.07
94 0.08
95 0.09
96 0.12
97 0.14
98 0.16
99 0.17
100 0.21
101 0.22
102 0.22
103 0.22
104 0.2
105 0.25
106 0.25
107 0.26
108 0.25
109 0.23
110 0.22
111 0.23
112 0.21
113 0.17
114 0.16
115 0.15
116 0.13
117 0.13
118 0.13
119 0.12
120 0.12
121 0.09
122 0.08
123 0.06
124 0.05
125 0.05
126 0.06
127 0.06
128 0.06
129 0.05
130 0.04
131 0.05
132 0.05
133 0.04
134 0.04
135 0.06
136 0.06
137 0.07
138 0.07
139 0.07
140 0.06
141 0.07
142 0.06
143 0.05
144 0.05
145 0.06
146 0.07
147 0.07
148 0.07
149 0.07
150 0.08
151 0.09
152 0.1
153 0.11
154 0.12
155 0.16
156 0.17
157 0.17
158 0.17
159 0.16
160 0.19
161 0.26
162 0.26
163 0.22
164 0.23
165 0.23
166 0.23
167 0.23
168 0.19
169 0.11
170 0.14
171 0.19
172 0.21
173 0.21
174 0.21
175 0.21
176 0.21
177 0.2
178 0.16
179 0.12
180 0.12
181 0.1
182 0.1
183 0.1
184 0.12
185 0.14
186 0.16
187 0.15
188 0.18
189 0.2
190 0.21
191 0.21
192 0.19
193 0.2
194 0.18
195 0.18
196 0.16
197 0.18
198 0.19
199 0.18
200 0.19
201 0.18
202 0.18
203 0.17
204 0.17
205 0.16
206 0.2
207 0.25
208 0.26
209 0.25
210 0.24
211 0.24
212 0.23
213 0.22
214 0.14
215 0.14
216 0.14
217 0.14
218 0.14
219 0.14
220 0.14
221 0.12
222 0.12
223 0.07
224 0.05
225 0.04
226 0.04
227 0.03
228 0.03
229 0.04
230 0.04
231 0.05
232 0.06
233 0.06
234 0.06
235 0.09
236 0.11
237 0.12
238 0.12
239 0.12
240 0.14
241 0.14
242 0.15
243 0.12
244 0.1
245 0.09
246 0.09
247 0.08
248 0.06
249 0.07
250 0.06
251 0.08
252 0.09
253 0.09
254 0.13
255 0.14