Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SB94

Protein Details
Accession M7SB94    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-34VPETLLKKRKSQEKARAEKSAEHydrophilic
NLS Segment(s)
PositionSequence
19-58KKRKSQEKARAEKSAEIEQRKKANKEKRGVIFKRAEKYVK
Subcellular Location(s) nucl 17, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR016082  Ribosomal_L30_ferredoxin-like  
IPR012988  Ribosomal_L30_N  
IPR039699  Ribosomal_L7/L30  
IPR005998  Ribosomal_L7_euk  
IPR035808  Ribosomal_L7_euk_arc  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG ela:UCREL1_11618  -  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
PF08079  Ribosomal_L30_N  
CDD cd01657  Ribosomal_L7_archeal_euk  
Amino Acid Sequences MAPTVPTQQDILVPETLLKKRKSQEKARAEKSAEIEQRKKANKEKRGVIFKRAEKYVKEYRDAEREKIRLHRVAKQEGAFQVDAEDKLIFVVRIKGINKIAPKPRKILQLLRLLQINNGVFVRISKATTEMLKVVEPWIAYGYPNLKTIKELIYKRGYGKINKQRVALTDNAIIEENLGKYGIICIEDLIHEIYTVGPNFKQASNFLWPFKLSNPTGGFRPRKFKHFIEGGDLGNREDKINALVRQMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.25
3 0.3
4 0.34
5 0.34
6 0.39
7 0.46
8 0.56
9 0.62
10 0.67
11 0.72
12 0.76
13 0.84
14 0.83
15 0.83
16 0.76
17 0.72
18 0.66
19 0.65
20 0.61
21 0.59
22 0.57
23 0.55
24 0.61
25 0.63
26 0.65
27 0.66
28 0.69
29 0.69
30 0.73
31 0.75
32 0.76
33 0.8
34 0.76
35 0.75
36 0.74
37 0.72
38 0.69
39 0.66
40 0.6
41 0.51
42 0.55
43 0.55
44 0.51
45 0.49
46 0.46
47 0.46
48 0.52
49 0.53
50 0.51
51 0.49
52 0.48
53 0.47
54 0.51
55 0.52
56 0.48
57 0.48
58 0.5
59 0.5
60 0.52
61 0.53
62 0.47
63 0.45
64 0.39
65 0.4
66 0.32
67 0.25
68 0.21
69 0.18
70 0.16
71 0.13
72 0.12
73 0.07
74 0.08
75 0.08
76 0.07
77 0.06
78 0.09
79 0.09
80 0.13
81 0.14
82 0.17
83 0.19
84 0.23
85 0.25
86 0.29
87 0.38
88 0.41
89 0.43
90 0.43
91 0.46
92 0.5
93 0.51
94 0.5
95 0.48
96 0.51
97 0.5
98 0.48
99 0.45
100 0.38
101 0.34
102 0.31
103 0.23
104 0.14
105 0.12
106 0.11
107 0.09
108 0.09
109 0.11
110 0.08
111 0.08
112 0.07
113 0.09
114 0.1
115 0.1
116 0.11
117 0.1
118 0.1
119 0.1
120 0.1
121 0.09
122 0.09
123 0.08
124 0.08
125 0.08
126 0.07
127 0.07
128 0.09
129 0.1
130 0.11
131 0.14
132 0.15
133 0.14
134 0.15
135 0.17
136 0.21
137 0.25
138 0.25
139 0.28
140 0.32
141 0.34
142 0.35
143 0.4
144 0.39
145 0.37
146 0.46
147 0.5
148 0.55
149 0.56
150 0.56
151 0.5
152 0.49
153 0.47
154 0.39
155 0.32
156 0.26
157 0.23
158 0.22
159 0.2
160 0.17
161 0.14
162 0.13
163 0.11
164 0.07
165 0.07
166 0.06
167 0.06
168 0.07
169 0.07
170 0.07
171 0.06
172 0.06
173 0.07
174 0.07
175 0.08
176 0.09
177 0.08
178 0.07
179 0.07
180 0.08
181 0.1
182 0.11
183 0.11
184 0.1
185 0.13
186 0.15
187 0.17
188 0.18
189 0.16
190 0.2
191 0.27
192 0.3
193 0.29
194 0.29
195 0.29
196 0.29
197 0.31
198 0.34
199 0.26
200 0.31
201 0.33
202 0.33
203 0.37
204 0.45
205 0.5
206 0.48
207 0.58
208 0.54
209 0.58
210 0.62
211 0.6
212 0.6
213 0.59
214 0.56
215 0.53
216 0.52
217 0.47
218 0.45
219 0.43
220 0.35
221 0.31
222 0.29
223 0.22
224 0.19
225 0.18
226 0.18
227 0.24
228 0.25