Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7T0X4

Protein Details
Accession M7T0X4    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
108-127ARKGIKPKTREQRSLKNRSFHydrophilic
NLS Segment(s)
PositionSequence
102-120KWEKFAARKGIKPKTREQR
181-198GGGGAKGAKGAKGKKRKA
Subcellular Location(s) cyto 12, mito 11, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
KEGG ela:UCREL1_2803  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MAATAKTKLDVAVNKPTPYTFDLGLLLANDPNPLNTSSADPSAPLEERLSAVARDGAQALINQLLTTTPLASTTDGVLLTLPATTTPLPREKPLPAAKETTKWEKFAARKGIKPKTREQRSLKNRSFNEETGEWERTWGHDRGGKATDRRRARDEGAVQRDWLVEVDENGEPEGASGGGGGGGGAKGAKGAKGKKRKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.4
4 0.37
5 0.34
6 0.32
7 0.22
8 0.19
9 0.19
10 0.18
11 0.19
12 0.15
13 0.13
14 0.11
15 0.1
16 0.1
17 0.09
18 0.09
19 0.11
20 0.11
21 0.12
22 0.12
23 0.15
24 0.16
25 0.18
26 0.17
27 0.16
28 0.16
29 0.18
30 0.18
31 0.16
32 0.14
33 0.13
34 0.14
35 0.15
36 0.15
37 0.11
38 0.11
39 0.12
40 0.11
41 0.11
42 0.11
43 0.1
44 0.09
45 0.09
46 0.09
47 0.08
48 0.08
49 0.07
50 0.06
51 0.06
52 0.06
53 0.07
54 0.06
55 0.05
56 0.06
57 0.07
58 0.07
59 0.08
60 0.07
61 0.08
62 0.07
63 0.08
64 0.07
65 0.06
66 0.05
67 0.05
68 0.04
69 0.03
70 0.05
71 0.05
72 0.07
73 0.09
74 0.14
75 0.16
76 0.17
77 0.2
78 0.2
79 0.27
80 0.32
81 0.32
82 0.3
83 0.33
84 0.33
85 0.34
86 0.37
87 0.38
88 0.33
89 0.31
90 0.31
91 0.32
92 0.34
93 0.36
94 0.43
95 0.38
96 0.41
97 0.49
98 0.57
99 0.56
100 0.58
101 0.6
102 0.61
103 0.66
104 0.7
105 0.68
106 0.7
107 0.75
108 0.81
109 0.77
110 0.75
111 0.68
112 0.66
113 0.64
114 0.54
115 0.49
116 0.39
117 0.38
118 0.34
119 0.35
120 0.27
121 0.23
122 0.23
123 0.2
124 0.24
125 0.2
126 0.18
127 0.19
128 0.2
129 0.23
130 0.27
131 0.29
132 0.32
133 0.38
134 0.44
135 0.49
136 0.53
137 0.53
138 0.55
139 0.54
140 0.55
141 0.56
142 0.58
143 0.57
144 0.53
145 0.48
146 0.44
147 0.41
148 0.33
149 0.25
150 0.16
151 0.1
152 0.1
153 0.13
154 0.12
155 0.13
156 0.12
157 0.12
158 0.1
159 0.09
160 0.09
161 0.06
162 0.05
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.03
169 0.03
170 0.04
171 0.04
172 0.04
173 0.06
174 0.07
175 0.11
176 0.17
177 0.27
178 0.37