Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SSA0

Protein Details
Accession M7SSA0    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
90-117GEHPNPKNAMKRRRHSQNKTYRDKYPKTBasic
NLS Segment(s)
PositionSequence
98-103AMKRRR
Subcellular Location(s) nucl 19, cyto 5, mito 3
Family & Domain DBs
KEGG ela:UCREL1_5616  -  
Amino Acid Sequences MPPNHPPPTIPNSPHAVLEKYQGQARLADATVGALEASVASIRQQLEYATKALEKNKAEAKKAHESVAKQEVVVAKLAAVQSQVGRDKSGEHPNPKNAMKRRRHSQNKTYRDKYPKTAEKMLDERMEKCRQRIKEVPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.43
3 0.37
4 0.3
5 0.32
6 0.31
7 0.28
8 0.29
9 0.28
10 0.26
11 0.24
12 0.24
13 0.22
14 0.18
15 0.16
16 0.13
17 0.11
18 0.1
19 0.08
20 0.07
21 0.04
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.07
29 0.07
30 0.08
31 0.08
32 0.09
33 0.11
34 0.13
35 0.13
36 0.11
37 0.13
38 0.15
39 0.17
40 0.23
41 0.21
42 0.23
43 0.3
44 0.32
45 0.33
46 0.35
47 0.38
48 0.41
49 0.41
50 0.41
51 0.37
52 0.34
53 0.36
54 0.38
55 0.32
56 0.22
57 0.23
58 0.21
59 0.19
60 0.18
61 0.13
62 0.07
63 0.09
64 0.09
65 0.08
66 0.06
67 0.06
68 0.06
69 0.1
70 0.13
71 0.12
72 0.12
73 0.12
74 0.15
75 0.21
76 0.3
77 0.33
78 0.38
79 0.42
80 0.47
81 0.54
82 0.55
83 0.58
84 0.57
85 0.61
86 0.64
87 0.68
88 0.72
89 0.77
90 0.84
91 0.85
92 0.86
93 0.87
94 0.87
95 0.89
96 0.84
97 0.82
98 0.81
99 0.77
100 0.74
101 0.74
102 0.73
103 0.7
104 0.73
105 0.67
106 0.65
107 0.64
108 0.62
109 0.58
110 0.51
111 0.47
112 0.47
113 0.53
114 0.49
115 0.52
116 0.55
117 0.52
118 0.59