Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SJC6

Protein Details
Accession M7SJC6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
305-326NDNNNNRNNNNKLRRRASRFWAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR021476  Egh16-like  
KEGG ela:UCREL1_8769  -  
Pfam View protein in Pfam  
PF11327  Egh16-like  
Amino Acid Sequences MSSLLRVLSFAAFAGLTQAHGVILGAQGIKGSPESVGFQVNSELPRNCTSINPCQQDTTIIRDAEIAANVVNECGRTELTGNIDIGENTENALAANQVTKVKAGTEMTVTIHQVNADGAGPYTCDLVEASNNGVISQNLTVADNVPGVNGFSQAKTQNFKVKVTMPDNFSCTGGSTGNICTVRCRNNAQAGPFGGCFPVQQVDGAASQNTAANIETGISLDKVNKQVKVDQQDLPVALQSIQDAGTDEALQNAAAVSSLLKISVTSLPAEVQTPDVILGGNADATATNDAATPTQTSGNGNNKNNDNNNNRNNNNKLRRRASRFWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.08
5 0.09
6 0.07
7 0.07
8 0.08
9 0.06
10 0.06
11 0.07
12 0.07
13 0.07
14 0.07
15 0.07
16 0.08
17 0.08
18 0.08
19 0.07
20 0.08
21 0.11
22 0.12
23 0.15
24 0.15
25 0.15
26 0.17
27 0.19
28 0.2
29 0.23
30 0.23
31 0.23
32 0.26
33 0.27
34 0.26
35 0.29
36 0.32
37 0.38
38 0.45
39 0.47
40 0.45
41 0.45
42 0.45
43 0.46
44 0.42
45 0.39
46 0.35
47 0.3
48 0.28
49 0.27
50 0.28
51 0.23
52 0.21
53 0.14
54 0.09
55 0.09
56 0.09
57 0.09
58 0.08
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.09
65 0.1
66 0.13
67 0.15
68 0.15
69 0.14
70 0.14
71 0.13
72 0.14
73 0.13
74 0.09
75 0.08
76 0.08
77 0.07
78 0.06
79 0.07
80 0.06
81 0.05
82 0.06
83 0.07
84 0.08
85 0.09
86 0.09
87 0.09
88 0.09
89 0.12
90 0.12
91 0.11
92 0.11
93 0.12
94 0.14
95 0.15
96 0.15
97 0.13
98 0.12
99 0.11
100 0.1
101 0.08
102 0.07
103 0.06
104 0.06
105 0.05
106 0.05
107 0.05
108 0.05
109 0.06
110 0.05
111 0.05
112 0.05
113 0.05
114 0.06
115 0.07
116 0.07
117 0.08
118 0.08
119 0.08
120 0.08
121 0.07
122 0.08
123 0.07
124 0.07
125 0.06
126 0.07
127 0.07
128 0.07
129 0.08
130 0.07
131 0.07
132 0.06
133 0.06
134 0.05
135 0.05
136 0.06
137 0.06
138 0.06
139 0.09
140 0.11
141 0.13
142 0.16
143 0.18
144 0.23
145 0.25
146 0.25
147 0.25
148 0.27
149 0.31
150 0.32
151 0.34
152 0.3
153 0.3
154 0.31
155 0.29
156 0.25
157 0.19
158 0.16
159 0.14
160 0.1
161 0.09
162 0.08
163 0.08
164 0.12
165 0.13
166 0.12
167 0.14
168 0.17
169 0.21
170 0.23
171 0.26
172 0.26
173 0.33
174 0.36
175 0.35
176 0.34
177 0.3
178 0.29
179 0.26
180 0.22
181 0.15
182 0.12
183 0.1
184 0.08
185 0.09
186 0.07
187 0.07
188 0.07
189 0.08
190 0.09
191 0.09
192 0.08
193 0.07
194 0.07
195 0.08
196 0.08
197 0.07
198 0.06
199 0.06
200 0.05
201 0.06
202 0.06
203 0.05
204 0.06
205 0.06
206 0.06
207 0.08
208 0.11
209 0.18
210 0.21
211 0.23
212 0.24
213 0.29
214 0.36
215 0.4
216 0.41
217 0.37
218 0.37
219 0.36
220 0.35
221 0.3
222 0.23
223 0.18
224 0.14
225 0.11
226 0.09
227 0.07
228 0.07
229 0.07
230 0.08
231 0.07
232 0.08
233 0.08
234 0.08
235 0.08
236 0.08
237 0.07
238 0.06
239 0.05
240 0.04
241 0.04
242 0.04
243 0.04
244 0.05
245 0.05
246 0.05
247 0.05
248 0.05
249 0.08
250 0.1
251 0.11
252 0.11
253 0.11
254 0.12
255 0.13
256 0.14
257 0.12
258 0.11
259 0.1
260 0.1
261 0.09
262 0.09
263 0.08
264 0.07
265 0.07
266 0.06
267 0.05
268 0.05
269 0.05
270 0.05
271 0.06
272 0.08
273 0.07
274 0.07
275 0.08
276 0.09
277 0.09
278 0.11
279 0.11
280 0.11
281 0.13
282 0.14
283 0.16
284 0.23
285 0.32
286 0.4
287 0.44
288 0.49
289 0.51
290 0.59
291 0.63
292 0.64
293 0.63
294 0.65
295 0.7
296 0.73
297 0.72
298 0.73
299 0.75
300 0.76
301 0.79
302 0.78
303 0.78
304 0.79
305 0.85
306 0.86