Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7SUF9

Protein Details
Accession M7SUF9    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
152-175ETTCETCKHKYKRRRNFILRAAPLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto 10, cyto_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR001394  Peptidase_C19_UCH  
IPR018200  USP_CS  
IPR028889  USP_dom  
Gene Ontology GO:0004843  F:cysteine-type deubiquitinase activity  
GO:0016579  P:protein deubiquitination  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
KEGG ela:UCREL1_11814  -  
Pfam View protein in Pfam  
PF00443  UCH  
PROSITE View protein in PROSITE  
PS00973  USP_2  
PS50235  USP_3  
CDD cd02257  Peptidase_C19  
Amino Acid Sequences MRAKLLMGYEYRNRLIKFGDNEQHDAEELTTFLLDQLDMETNTKRNINAIEPDFKTPKIHNQKAPLGDVLNTWLAYYDRHRSIVDKYWQNVISQEFTCMNPACSAKSYKLEAEPFIVAYPAAETQIRGGSSSEIDSLPAAVDREFAPDEVLETTCETCKHKYKRRRNFILRAAPLLCVKVLRTIHTAKVPLKNTFPMEFPFDDLDLRRHSYVDDKAQLRPFLTAAAAAAAAGGKRLPEGMLGGYEEDPVYDLYAIVIHSGTDSHSGHYWTWVREGSGNLWTRCNDSRIDEAEMDSRTQRDLFECRAKETPVMLFYKRKDIPWASRDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.41
4 0.4
5 0.44
6 0.48
7 0.46
8 0.5
9 0.49
10 0.46
11 0.39
12 0.34
13 0.25
14 0.18
15 0.13
16 0.1
17 0.08
18 0.07
19 0.07
20 0.07
21 0.06
22 0.06
23 0.08
24 0.1
25 0.11
26 0.13
27 0.15
28 0.17
29 0.21
30 0.22
31 0.2
32 0.21
33 0.23
34 0.26
35 0.31
36 0.33
37 0.38
38 0.38
39 0.44
40 0.43
41 0.41
42 0.4
43 0.35
44 0.41
45 0.45
46 0.5
47 0.51
48 0.56
49 0.62
50 0.62
51 0.62
52 0.53
53 0.43
54 0.36
55 0.3
56 0.25
57 0.2
58 0.16
59 0.13
60 0.12
61 0.11
62 0.12
63 0.16
64 0.2
65 0.21
66 0.23
67 0.24
68 0.25
69 0.29
70 0.36
71 0.41
72 0.4
73 0.4
74 0.45
75 0.45
76 0.43
77 0.41
78 0.34
79 0.29
80 0.23
81 0.24
82 0.19
83 0.18
84 0.22
85 0.19
86 0.18
87 0.17
88 0.17
89 0.16
90 0.18
91 0.2
92 0.19
93 0.23
94 0.24
95 0.23
96 0.27
97 0.27
98 0.26
99 0.25
100 0.23
101 0.19
102 0.17
103 0.15
104 0.1
105 0.08
106 0.08
107 0.05
108 0.06
109 0.06
110 0.06
111 0.07
112 0.09
113 0.09
114 0.09
115 0.09
116 0.09
117 0.1
118 0.1
119 0.1
120 0.08
121 0.08
122 0.08
123 0.07
124 0.06
125 0.06
126 0.06
127 0.05
128 0.06
129 0.06
130 0.08
131 0.08
132 0.08
133 0.08
134 0.08
135 0.09
136 0.09
137 0.09
138 0.07
139 0.07
140 0.08
141 0.08
142 0.1
143 0.11
144 0.14
145 0.23
146 0.32
147 0.41
148 0.51
149 0.61
150 0.71
151 0.79
152 0.86
153 0.86
154 0.86
155 0.86
156 0.84
157 0.75
158 0.67
159 0.57
160 0.47
161 0.39
162 0.3
163 0.21
164 0.12
165 0.11
166 0.13
167 0.13
168 0.14
169 0.17
170 0.19
171 0.21
172 0.24
173 0.27
174 0.26
175 0.32
176 0.33
177 0.31
178 0.32
179 0.33
180 0.33
181 0.3
182 0.28
183 0.22
184 0.23
185 0.21
186 0.21
187 0.18
188 0.16
189 0.16
190 0.15
191 0.16
192 0.15
193 0.17
194 0.15
195 0.15
196 0.15
197 0.19
198 0.22
199 0.25
200 0.3
201 0.29
202 0.34
203 0.37
204 0.38
205 0.33
206 0.3
207 0.24
208 0.18
209 0.16
210 0.11
211 0.08
212 0.07
213 0.06
214 0.05
215 0.05
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.05
224 0.05
225 0.06
226 0.06
227 0.07
228 0.08
229 0.09
230 0.09
231 0.09
232 0.09
233 0.07
234 0.08
235 0.07
236 0.07
237 0.06
238 0.05
239 0.05
240 0.06
241 0.06
242 0.06
243 0.06
244 0.05
245 0.05
246 0.05
247 0.06
248 0.1
249 0.1
250 0.12
251 0.13
252 0.16
253 0.16
254 0.22
255 0.25
256 0.22
257 0.25
258 0.24
259 0.24
260 0.25
261 0.26
262 0.22
263 0.27
264 0.32
265 0.3
266 0.32
267 0.32
268 0.34
269 0.35
270 0.35
271 0.29
272 0.27
273 0.32
274 0.32
275 0.36
276 0.32
277 0.3
278 0.33
279 0.31
280 0.29
281 0.25
282 0.22
283 0.2
284 0.2
285 0.19
286 0.19
287 0.23
288 0.29
289 0.37
290 0.38
291 0.41
292 0.44
293 0.45
294 0.43
295 0.41
296 0.38
297 0.34
298 0.37
299 0.36
300 0.4
301 0.4
302 0.48
303 0.48
304 0.45
305 0.48
306 0.52
307 0.57