Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7T0I2

Protein Details
Accession M7T0I2    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
35-64SRQTTDRDERRAHKKKKRRRAKEGAVSEVNBasic
66-106GSESRKRKNSLSKAARDPRDEPERRKKKKAKAEGTETRSPSBasic
NLS Segment(s)
PositionSequence
44-97RRAHKKKKRRRAKEGAVSEVNGGSESRKRKNSLSKAARDPRDEPERRKKKKAKA
Subcellular Location(s) nucl 13.5, cyto_nucl 11.833, mito_nucl 9.166, cyto 8, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043133  GTP-CH-I_C/QueF  
IPR043134  GTP-CH-I_N  
IPR001474  GTP_CycHdrlase_I  
IPR018234  GTP_CycHdrlase_I_CS  
IPR020602  GTP_CycHdrlase_I_dom  
Gene Ontology GO:0003934  F:GTP cyclohydrolase I activity  
GO:0035998  P:7,8-dihydroneopterin 3'-triphosphate biosynthetic process  
GO:0046656  P:folic acid biosynthetic process  
GO:0046654  P:tetrahydrofolate biosynthetic process  
KEGG ela:UCREL1_9712  -  
Pfam View protein in Pfam  
PF01227  GTP_cyclohydroI  
PROSITE View protein in PROSITE  
PS00859  GTP_CYCLOHYDROL_1_1  
PS00860  GTP_CYCLOHYDROL_1_2  
CDD cd00642  GTP_cyclohydro1  
Amino Acid Sequences MVEFAESKRGDRETALSSSSAVSLSDVDDSPHEGSRQTTDRDERRAHKKKKRRRAKEGAVSEVNGGSESRKRKNSLSKAARDPRDEPERRKKKKAKAEGTETRSPSPVIDFDGLSRPSRGTRERLEESPEQAALRLDKLRGACRTILECIGEDPDREGVLGTPDRYAKAMLYFTKGYQQNVGDIVNGAIFHEGHNEMVIVKDIEIFSLCEHHMVPFNGKMHIGYIPNNNVIGISKLPRIAEMFARRLQVQERLTREVANAIMEVLKPQGVAVVMDSSHLCMVMRGVQKTTASTITSCVLGCFERKEKTRTEFLSLLGLPGGHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.24
4 0.23
5 0.23
6 0.21
7 0.17
8 0.12
9 0.1
10 0.09
11 0.09
12 0.11
13 0.1
14 0.11
15 0.11
16 0.15
17 0.16
18 0.18
19 0.17
20 0.15
21 0.17
22 0.23
23 0.27
24 0.27
25 0.32
26 0.39
27 0.45
28 0.52
29 0.58
30 0.6
31 0.66
32 0.74
33 0.77
34 0.79
35 0.84
36 0.87
37 0.9
38 0.94
39 0.93
40 0.93
41 0.94
42 0.94
43 0.94
44 0.9
45 0.87
46 0.78
47 0.68
48 0.58
49 0.47
50 0.36
51 0.26
52 0.18
53 0.13
54 0.16
55 0.22
56 0.28
57 0.33
58 0.36
59 0.44
60 0.54
61 0.62
62 0.67
63 0.7
64 0.71
65 0.76
66 0.82
67 0.8
68 0.74
69 0.67
70 0.64
71 0.65
72 0.63
73 0.62
74 0.64
75 0.69
76 0.72
77 0.8
78 0.82
79 0.81
80 0.85
81 0.87
82 0.86
83 0.84
84 0.87
85 0.85
86 0.83
87 0.8
88 0.72
89 0.63
90 0.53
91 0.44
92 0.34
93 0.27
94 0.2
95 0.16
96 0.14
97 0.13
98 0.13
99 0.19
100 0.2
101 0.19
102 0.18
103 0.16
104 0.17
105 0.22
106 0.24
107 0.24
108 0.27
109 0.34
110 0.37
111 0.38
112 0.42
113 0.39
114 0.38
115 0.34
116 0.3
117 0.22
118 0.19
119 0.18
120 0.13
121 0.13
122 0.12
123 0.1
124 0.12
125 0.14
126 0.18
127 0.18
128 0.2
129 0.19
130 0.19
131 0.21
132 0.2
133 0.19
134 0.15
135 0.13
136 0.12
137 0.13
138 0.11
139 0.1
140 0.09
141 0.09
142 0.08
143 0.08
144 0.07
145 0.05
146 0.08
147 0.09
148 0.08
149 0.09
150 0.1
151 0.1
152 0.1
153 0.11
154 0.08
155 0.09
156 0.11
157 0.11
158 0.14
159 0.14
160 0.14
161 0.21
162 0.22
163 0.21
164 0.22
165 0.21
166 0.19
167 0.19
168 0.19
169 0.12
170 0.1
171 0.1
172 0.07
173 0.07
174 0.06
175 0.05
176 0.05
177 0.05
178 0.06
179 0.07
180 0.06
181 0.07
182 0.06
183 0.06
184 0.06
185 0.07
186 0.05
187 0.05
188 0.06
189 0.06
190 0.06
191 0.07
192 0.07
193 0.06
194 0.09
195 0.09
196 0.08
197 0.08
198 0.09
199 0.13
200 0.13
201 0.16
202 0.18
203 0.19
204 0.19
205 0.19
206 0.18
207 0.15
208 0.17
209 0.17
210 0.15
211 0.19
212 0.21
213 0.22
214 0.22
215 0.2
216 0.18
217 0.17
218 0.15
219 0.12
220 0.12
221 0.12
222 0.14
223 0.14
224 0.15
225 0.16
226 0.16
227 0.22
228 0.25
229 0.28
230 0.29
231 0.31
232 0.3
233 0.31
234 0.32
235 0.32
236 0.31
237 0.33
238 0.35
239 0.38
240 0.39
241 0.38
242 0.36
243 0.31
244 0.27
245 0.21
246 0.16
247 0.11
248 0.11
249 0.1
250 0.1
251 0.09
252 0.08
253 0.07
254 0.07
255 0.08
256 0.07
257 0.07
258 0.08
259 0.09
260 0.08
261 0.09
262 0.1
263 0.1
264 0.09
265 0.09
266 0.08
267 0.07
268 0.08
269 0.15
270 0.2
271 0.21
272 0.22
273 0.25
274 0.26
275 0.28
276 0.3
277 0.25
278 0.22
279 0.2
280 0.21
281 0.19
282 0.2
283 0.18
284 0.15
285 0.14
286 0.14
287 0.16
288 0.2
289 0.25
290 0.31
291 0.37
292 0.41
293 0.47
294 0.51
295 0.58
296 0.56
297 0.57
298 0.51
299 0.47
300 0.5
301 0.43
302 0.37
303 0.28