Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TR61

Protein Details
Accession M7TR61   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
56-78EEISRRGGKKDGKKDKKKSDVAVBasic
NLS Segment(s)
PositionSequence
51-73GRRKPEEISRRGGKKDGKKDKKK
Subcellular Location(s) cyto 13.5, cyto_nucl 12, nucl 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG ela:UCREL1_469  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MEHRHLDNNDISKIIGRDWHALGEEGQKPWKVEAERLKREFMLAHPDYKYGRRKPEEISRRGGKKDGKKDKKKSDVAVPAPDDASLSNVVPVANVAPAANVAAVTNHATATNHTPTTNHAPAANHAPAASVPNDFPAPNGIGFAGAAPGTVVGTSARGTVAGGAGFASGESNGVLVNDPIFFQGSDSPDNPNNGLDFDFNNFDFNPGSIFHSQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.21
4 0.24
5 0.24
6 0.26
7 0.23
8 0.23
9 0.24
10 0.26
11 0.26
12 0.24
13 0.27
14 0.27
15 0.27
16 0.28
17 0.32
18 0.27
19 0.31
20 0.4
21 0.46
22 0.54
23 0.56
24 0.57
25 0.51
26 0.5
27 0.44
28 0.36
29 0.35
30 0.27
31 0.29
32 0.27
33 0.29
34 0.3
35 0.36
36 0.43
37 0.39
38 0.48
39 0.48
40 0.5
41 0.55
42 0.63
43 0.66
44 0.62
45 0.63
46 0.62
47 0.63
48 0.62
49 0.62
50 0.59
51 0.58
52 0.64
53 0.67
54 0.7
55 0.75
56 0.83
57 0.87
58 0.89
59 0.85
60 0.78
61 0.76
62 0.74
63 0.68
64 0.63
65 0.54
66 0.45
67 0.39
68 0.35
69 0.26
70 0.16
71 0.14
72 0.09
73 0.07
74 0.07
75 0.07
76 0.07
77 0.06
78 0.06
79 0.05
80 0.04
81 0.04
82 0.04
83 0.03
84 0.04
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.04
91 0.05
92 0.05
93 0.05
94 0.06
95 0.06
96 0.07
97 0.11
98 0.13
99 0.13
100 0.12
101 0.13
102 0.16
103 0.24
104 0.24
105 0.2
106 0.19
107 0.19
108 0.21
109 0.26
110 0.23
111 0.16
112 0.14
113 0.14
114 0.12
115 0.14
116 0.13
117 0.08
118 0.07
119 0.09
120 0.1
121 0.09
122 0.09
123 0.1
124 0.1
125 0.09
126 0.1
127 0.08
128 0.07
129 0.07
130 0.07
131 0.06
132 0.04
133 0.04
134 0.03
135 0.03
136 0.03
137 0.03
138 0.04
139 0.03
140 0.04
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.06
147 0.06
148 0.05
149 0.05
150 0.05
151 0.05
152 0.04
153 0.04
154 0.04
155 0.03
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.05
162 0.05
163 0.06
164 0.06
165 0.06
166 0.07
167 0.08
168 0.08
169 0.08
170 0.12
171 0.15
172 0.19
173 0.19
174 0.24
175 0.26
176 0.29
177 0.28
178 0.26
179 0.23
180 0.21
181 0.21
182 0.18
183 0.16
184 0.17
185 0.19
186 0.18
187 0.2
188 0.19
189 0.19
190 0.18
191 0.17
192 0.15
193 0.13
194 0.18