Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TMM5

Protein Details
Accession M7TMM5   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
407-430PAPDDKPSRKRGGRRARKAKEATABasic
NLS Segment(s)
PositionSequence
408-427APDDKPSRKRGGRRARKAKE
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR042239  Nop_C  
IPR002687  Nop_dom  
IPR036070  Nop_dom_sf  
IPR012976  NOSIC  
IPR027105  Prp31  
IPR019175  Prp31_C  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0003723  F:RNA binding  
GO:0000244  P:spliceosomal tri-snRNP complex assembly  
KEGG ela:UCREL1_1822  -  
Pfam View protein in Pfam  
PF01798  Nop  
PF09785  Prp31_C  
PROSITE View protein in PROSITE  
PS51358  NOP  
Amino Acid Sequences MSTLADELLQDFEDSGSENGEEQLDTEVDGGPESDGFVLRHQHHNNPDADMVLDGDEEDEPEQEDEEMGGTGVPATLDTIQDEEAAKAQVEKMQLGSVKDIRKVTRLMDRLEPLLKDIARYQSQPLNLQTVNIGNIEDNPEYKILTESNTLSTQIDGEVMIIHKFIRDHYSARFPELEMLIQNPIEYAKVVAIIGNGPMDSDTIKALQSSTENPLGESLKSVLDGPSLMVVTVEATTTKGHELSKDELDRILRACHMIIAIDKAKKTLTEYVQSRMNIFAPNLTIIVGSLTAAQLINTAGGLTNLSRTPACNLAAWGSKRQNSAFATNVTVRQQGYLYHSPIIRGIPSDLKKKAMKAVAAKLVLAARADTGHTNPDGSYGEELRVQCLERLDKMTEPPPNKGQRALPAPDDKPSRKRGGRRARKAKEATAVTELRKAQNRMAFGKEEKETGYGTGDSTSGLGMIGQSGDGRIRSLQIDNRTRAKLSQKHKGWGGATSISGSASSMRSLGQSGGNIDLRGKGLRTSGVGSSIGGGAGTASSLAFTPVQGLELVDPKMQAELSRKRKAEEDRWFQGGTFTRVGGTSSGSTGGFKVPELPPNKKVDTGAGKMGPPPAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.09
5 0.1
6 0.1
7 0.11
8 0.11
9 0.1
10 0.12
11 0.1
12 0.1
13 0.11
14 0.11
15 0.1
16 0.1
17 0.1
18 0.08
19 0.08
20 0.08
21 0.08
22 0.09
23 0.1
24 0.12
25 0.19
26 0.23
27 0.32
28 0.36
29 0.43
30 0.48
31 0.54
32 0.53
33 0.49
34 0.47
35 0.38
36 0.34
37 0.26
38 0.2
39 0.13
40 0.11
41 0.08
42 0.08
43 0.07
44 0.08
45 0.08
46 0.07
47 0.08
48 0.09
49 0.09
50 0.08
51 0.09
52 0.08
53 0.08
54 0.08
55 0.06
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.06
63 0.06
64 0.07
65 0.08
66 0.09
67 0.09
68 0.11
69 0.12
70 0.11
71 0.12
72 0.12
73 0.12
74 0.11
75 0.12
76 0.13
77 0.14
78 0.14
79 0.14
80 0.16
81 0.19
82 0.19
83 0.24
84 0.27
85 0.29
86 0.33
87 0.37
88 0.35
89 0.37
90 0.37
91 0.36
92 0.4
93 0.41
94 0.4
95 0.42
96 0.42
97 0.42
98 0.43
99 0.39
100 0.32
101 0.32
102 0.29
103 0.24
104 0.25
105 0.28
106 0.27
107 0.29
108 0.3
109 0.3
110 0.32
111 0.35
112 0.34
113 0.33
114 0.3
115 0.29
116 0.26
117 0.23
118 0.22
119 0.17
120 0.16
121 0.1
122 0.11
123 0.15
124 0.14
125 0.13
126 0.13
127 0.13
128 0.12
129 0.13
130 0.13
131 0.1
132 0.12
133 0.14
134 0.14
135 0.17
136 0.18
137 0.18
138 0.17
139 0.16
140 0.15
141 0.12
142 0.11
143 0.07
144 0.06
145 0.07
146 0.07
147 0.07
148 0.07
149 0.07
150 0.08
151 0.08
152 0.09
153 0.13
154 0.15
155 0.17
156 0.21
157 0.31
158 0.3
159 0.33
160 0.32
161 0.28
162 0.29
163 0.27
164 0.24
165 0.15
166 0.16
167 0.14
168 0.13
169 0.12
170 0.09
171 0.08
172 0.07
173 0.07
174 0.06
175 0.05
176 0.06
177 0.06
178 0.06
179 0.06
180 0.06
181 0.07
182 0.06
183 0.06
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.06
190 0.06
191 0.07
192 0.07
193 0.07
194 0.08
195 0.09
196 0.11
197 0.14
198 0.17
199 0.17
200 0.17
201 0.19
202 0.19
203 0.18
204 0.16
205 0.13
206 0.1
207 0.1
208 0.1
209 0.08
210 0.08
211 0.08
212 0.07
213 0.07
214 0.06
215 0.06
216 0.05
217 0.05
218 0.05
219 0.05
220 0.05
221 0.04
222 0.05
223 0.05
224 0.06
225 0.07
226 0.08
227 0.08
228 0.1
229 0.14
230 0.16
231 0.22
232 0.22
233 0.22
234 0.22
235 0.22
236 0.22
237 0.19
238 0.17
239 0.12
240 0.11
241 0.11
242 0.09
243 0.09
244 0.08
245 0.07
246 0.1
247 0.13
248 0.14
249 0.14
250 0.15
251 0.15
252 0.15
253 0.17
254 0.2
255 0.19
256 0.25
257 0.27
258 0.29
259 0.33
260 0.33
261 0.31
262 0.26
263 0.24
264 0.18
265 0.16
266 0.14
267 0.1
268 0.1
269 0.09
270 0.08
271 0.07
272 0.05
273 0.05
274 0.04
275 0.04
276 0.04
277 0.04
278 0.04
279 0.04
280 0.04
281 0.04
282 0.04
283 0.04
284 0.03
285 0.04
286 0.03
287 0.03
288 0.04
289 0.03
290 0.05
291 0.05
292 0.06
293 0.06
294 0.06
295 0.08
296 0.1
297 0.11
298 0.1
299 0.11
300 0.12
301 0.17
302 0.18
303 0.22
304 0.22
305 0.24
306 0.26
307 0.26
308 0.29
309 0.26
310 0.28
311 0.24
312 0.22
313 0.22
314 0.21
315 0.23
316 0.19
317 0.19
318 0.16
319 0.14
320 0.14
321 0.12
322 0.18
323 0.2
324 0.2
325 0.21
326 0.21
327 0.2
328 0.21
329 0.2
330 0.14
331 0.11
332 0.11
333 0.16
334 0.19
335 0.25
336 0.25
337 0.29
338 0.31
339 0.31
340 0.35
341 0.32
342 0.32
343 0.31
344 0.35
345 0.36
346 0.35
347 0.33
348 0.28
349 0.26
350 0.22
351 0.17
352 0.12
353 0.06
354 0.06
355 0.07
356 0.07
357 0.07
358 0.09
359 0.09
360 0.09
361 0.09
362 0.1
363 0.1
364 0.1
365 0.12
366 0.1
367 0.11
368 0.14
369 0.14
370 0.13
371 0.14
372 0.13
373 0.13
374 0.15
375 0.16
376 0.14
377 0.17
378 0.18
379 0.18
380 0.21
381 0.24
382 0.28
383 0.29
384 0.31
385 0.36
386 0.41
387 0.41
388 0.42
389 0.4
390 0.4
391 0.44
392 0.42
393 0.39
394 0.39
395 0.39
396 0.41
397 0.46
398 0.43
399 0.44
400 0.48
401 0.52
402 0.52
403 0.6
404 0.64
405 0.69
406 0.75
407 0.8
408 0.85
409 0.82
410 0.85
411 0.82
412 0.76
413 0.72
414 0.64
415 0.56
416 0.51
417 0.48
418 0.39
419 0.39
420 0.36
421 0.33
422 0.36
423 0.35
424 0.34
425 0.34
426 0.37
427 0.35
428 0.37
429 0.36
430 0.31
431 0.34
432 0.31
433 0.28
434 0.25
435 0.23
436 0.21
437 0.17
438 0.18
439 0.13
440 0.12
441 0.12
442 0.11
443 0.09
444 0.09
445 0.08
446 0.06
447 0.05
448 0.04
449 0.04
450 0.04
451 0.04
452 0.04
453 0.04
454 0.04
455 0.06
456 0.06
457 0.07
458 0.07
459 0.09
460 0.11
461 0.15
462 0.2
463 0.29
464 0.37
465 0.41
466 0.46
467 0.47
468 0.46
469 0.47
470 0.51
471 0.5
472 0.5
473 0.55
474 0.55
475 0.59
476 0.62
477 0.62
478 0.54
479 0.48
480 0.45
481 0.36
482 0.3
483 0.25
484 0.22
485 0.16
486 0.15
487 0.12
488 0.1
489 0.09
490 0.09
491 0.08
492 0.09
493 0.09
494 0.1
495 0.12
496 0.12
497 0.12
498 0.13
499 0.18
500 0.18
501 0.18
502 0.18
503 0.18
504 0.17
505 0.18
506 0.17
507 0.14
508 0.14
509 0.16
510 0.17
511 0.18
512 0.17
513 0.18
514 0.18
515 0.16
516 0.16
517 0.14
518 0.12
519 0.09
520 0.08
521 0.05
522 0.05
523 0.05
524 0.04
525 0.03
526 0.04
527 0.04
528 0.06
529 0.06
530 0.06
531 0.08
532 0.08
533 0.09
534 0.09
535 0.1
536 0.1
537 0.14
538 0.16
539 0.15
540 0.15
541 0.14
542 0.15
543 0.15
544 0.16
545 0.21
546 0.3
547 0.39
548 0.48
549 0.49
550 0.5
551 0.58
552 0.64
553 0.65
554 0.66
555 0.65
556 0.62
557 0.65
558 0.63
559 0.55
560 0.53
561 0.47
562 0.42
563 0.34
564 0.28
565 0.25
566 0.25
567 0.26
568 0.2
569 0.18
570 0.14
571 0.13
572 0.15
573 0.14
574 0.15
575 0.15
576 0.17
577 0.14
578 0.13
579 0.18
580 0.2
581 0.27
582 0.33
583 0.39
584 0.43
585 0.5
586 0.52
587 0.49
588 0.48
589 0.49
590 0.51
591 0.48
592 0.49
593 0.45
594 0.43
595 0.43