Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SZK8

Protein Details
Accession M7SZK8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
38-59DADVETKKRGRRHPNPLASLKIHydrophilic
NLS Segment(s)
PositionSequence
32-34KKK
43-50TKKRGRRH
Subcellular Location(s) plas 20, mito 3, E.R. 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0016020  C:membrane  
KEGG ela:UCREL1_3241  -  
Amino Acid Sequences MPETCRAVVGNGSVPPPRWQLSLLQYIRQRGKKKENPDADVETKKRGRRHPNPLASLKIAGEKEAGMILWYGSLLYSGYFAVLSTLSTQLGQRYGFDSLQIGLCYLPLGIGSLTSRWTVGRLLDKNFHRIARLRGIPIIHNRQQDISKFPIELARLQISIPLIYAACCAMVAYSWVMNYKTHLAGPLVMLFFTGHLVTGSFSALNTLVVDINMGTPATAVAANNLFRCLMGAGATAIANPLIDRVGIGWTGTFIAFLWALFSPSLWAVMRYGPRWRAEAQAKAERKAAKNATVDPETGASSEKIHEPSEENDNKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.3
4 0.29
5 0.27
6 0.26
7 0.3
8 0.34
9 0.43
10 0.41
11 0.43
12 0.44
13 0.51
14 0.58
15 0.6
16 0.61
17 0.6
18 0.69
19 0.71
20 0.77
21 0.79
22 0.8
23 0.76
24 0.76
25 0.73
26 0.69
27 0.69
28 0.62
29 0.6
30 0.57
31 0.58
32 0.59
33 0.61
34 0.66
35 0.67
36 0.76
37 0.78
38 0.82
39 0.84
40 0.82
41 0.77
42 0.68
43 0.59
44 0.49
45 0.44
46 0.34
47 0.26
48 0.22
49 0.17
50 0.15
51 0.13
52 0.12
53 0.07
54 0.07
55 0.06
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.04
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.06
72 0.07
73 0.07
74 0.08
75 0.09
76 0.09
77 0.12
78 0.12
79 0.11
80 0.12
81 0.15
82 0.14
83 0.14
84 0.13
85 0.12
86 0.13
87 0.12
88 0.1
89 0.07
90 0.07
91 0.07
92 0.06
93 0.05
94 0.03
95 0.04
96 0.04
97 0.04
98 0.05
99 0.05
100 0.07
101 0.07
102 0.07
103 0.07
104 0.08
105 0.09
106 0.11
107 0.18
108 0.2
109 0.23
110 0.3
111 0.31
112 0.35
113 0.37
114 0.35
115 0.3
116 0.3
117 0.31
118 0.32
119 0.33
120 0.29
121 0.28
122 0.29
123 0.29
124 0.33
125 0.37
126 0.34
127 0.33
128 0.33
129 0.33
130 0.34
131 0.32
132 0.29
133 0.25
134 0.21
135 0.19
136 0.19
137 0.19
138 0.18
139 0.17
140 0.16
141 0.14
142 0.13
143 0.13
144 0.14
145 0.11
146 0.1
147 0.09
148 0.07
149 0.05
150 0.05
151 0.06
152 0.04
153 0.04
154 0.04
155 0.03
156 0.03
157 0.03
158 0.04
159 0.04
160 0.04
161 0.04
162 0.06
163 0.07
164 0.07
165 0.09
166 0.11
167 0.11
168 0.11
169 0.12
170 0.11
171 0.11
172 0.11
173 0.12
174 0.09
175 0.08
176 0.09
177 0.07
178 0.07
179 0.07
180 0.06
181 0.04
182 0.04
183 0.05
184 0.05
185 0.05
186 0.06
187 0.05
188 0.05
189 0.06
190 0.06
191 0.06
192 0.05
193 0.06
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.04
202 0.04
203 0.04
204 0.04
205 0.05
206 0.04
207 0.06
208 0.08
209 0.1
210 0.1
211 0.11
212 0.1
213 0.1
214 0.1
215 0.09
216 0.07
217 0.06
218 0.06
219 0.06
220 0.06
221 0.06
222 0.06
223 0.06
224 0.05
225 0.05
226 0.04
227 0.04
228 0.04
229 0.04
230 0.04
231 0.05
232 0.06
233 0.06
234 0.06
235 0.06
236 0.06
237 0.07
238 0.07
239 0.07
240 0.05
241 0.07
242 0.07
243 0.07
244 0.08
245 0.07
246 0.09
247 0.09
248 0.09
249 0.08
250 0.09
251 0.11
252 0.1
253 0.1
254 0.1
255 0.16
256 0.2
257 0.21
258 0.29
259 0.31
260 0.34
261 0.36
262 0.37
263 0.41
264 0.44
265 0.49
266 0.49
267 0.54
268 0.56
269 0.55
270 0.59
271 0.57
272 0.53
273 0.55
274 0.52
275 0.5
276 0.5
277 0.53
278 0.54
279 0.5
280 0.47
281 0.39
282 0.35
283 0.29
284 0.24
285 0.21
286 0.15
287 0.14
288 0.16
289 0.19
290 0.2
291 0.2
292 0.22
293 0.23
294 0.26
295 0.35