Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SXT4

Protein Details
Accession M7SXT4   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-24ARPPKQQSTNAPPTPKRKRAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG ela:UCREL1_10677  -  
Amino Acid Sequences MAAPARPPKQQSTNAPPTPKRKRAADTSNSPAMSEEPSSKKVRLGESLNLPSQSEIAAANSMEGKYDIQLQNVISSSKIQNRVIAVLQHIGGGATPTSTSTSTSTTSDTKHKTKISVLRAKAADAGKLITIAEIAKRELEKEKDVATTTELRWFQYIALGEEIKERPRDQGKKKTTKDGDTAMDDDCDDDDDDDGDFETMKTPFERAIEKQPLIRGTPVMSLFLSRVPIEELKKKYGEQTNASPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.77
3 0.76
4 0.79
5 0.81
6 0.8
7 0.76
8 0.73
9 0.73
10 0.74
11 0.77
12 0.76
13 0.73
14 0.72
15 0.72
16 0.64
17 0.57
18 0.48
19 0.38
20 0.32
21 0.26
22 0.25
23 0.23
24 0.28
25 0.31
26 0.31
27 0.34
28 0.35
29 0.37
30 0.37
31 0.37
32 0.38
33 0.43
34 0.47
35 0.46
36 0.42
37 0.38
38 0.32
39 0.28
40 0.21
41 0.14
42 0.09
43 0.08
44 0.08
45 0.08
46 0.08
47 0.09
48 0.09
49 0.08
50 0.09
51 0.08
52 0.08
53 0.16
54 0.16
55 0.15
56 0.17
57 0.17
58 0.18
59 0.19
60 0.18
61 0.11
62 0.13
63 0.15
64 0.2
65 0.25
66 0.24
67 0.25
68 0.26
69 0.28
70 0.26
71 0.24
72 0.19
73 0.15
74 0.14
75 0.12
76 0.11
77 0.09
78 0.07
79 0.06
80 0.05
81 0.04
82 0.04
83 0.04
84 0.06
85 0.06
86 0.08
87 0.09
88 0.11
89 0.12
90 0.13
91 0.15
92 0.15
93 0.17
94 0.22
95 0.26
96 0.28
97 0.32
98 0.32
99 0.32
100 0.36
101 0.41
102 0.44
103 0.47
104 0.45
105 0.45
106 0.44
107 0.42
108 0.41
109 0.34
110 0.25
111 0.17
112 0.16
113 0.11
114 0.1
115 0.1
116 0.05
117 0.05
118 0.05
119 0.05
120 0.06
121 0.06
122 0.07
123 0.08
124 0.09
125 0.13
126 0.16
127 0.17
128 0.18
129 0.19
130 0.19
131 0.2
132 0.19
133 0.17
134 0.18
135 0.16
136 0.21
137 0.2
138 0.19
139 0.19
140 0.19
141 0.16
142 0.16
143 0.16
144 0.11
145 0.13
146 0.13
147 0.12
148 0.16
149 0.17
150 0.17
151 0.18
152 0.17
153 0.21
154 0.31
155 0.4
156 0.45
157 0.54
158 0.62
159 0.71
160 0.74
161 0.79
162 0.76
163 0.72
164 0.67
165 0.61
166 0.55
167 0.47
168 0.45
169 0.35
170 0.29
171 0.23
172 0.19
173 0.14
174 0.12
175 0.09
176 0.08
177 0.07
178 0.07
179 0.07
180 0.07
181 0.07
182 0.06
183 0.06
184 0.05
185 0.08
186 0.08
187 0.09
188 0.1
189 0.1
190 0.12
191 0.14
192 0.19
193 0.2
194 0.3
195 0.37
196 0.38
197 0.4
198 0.43
199 0.44
200 0.42
201 0.4
202 0.31
203 0.25
204 0.28
205 0.26
206 0.23
207 0.2
208 0.19
209 0.18
210 0.18
211 0.19
212 0.14
213 0.14
214 0.16
215 0.21
216 0.26
217 0.34
218 0.37
219 0.4
220 0.43
221 0.43
222 0.48
223 0.52
224 0.53
225 0.51