Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7T6I8

Protein Details
Accession M7T6I8   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-30GNKSAMKKARKGTEKKKPGSQLKSNHydrophilic
76-96GKVKNEEEEQKKNKKKKTPTKBasic
NLS Segment(s)
PositionSequence
9-24SAMKKARKGTEKKKPG
86-96KKNKKKKTPTK
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR026939  ZNF706/At2g23090_sf  
KEGG ela:UCREL1_7582  -  
Amino Acid Sequences MGGGNGNKSAMKKARKGTEKKKPGSQLKSNEAAKSEICRWCMKAFQGTCHINEYKAHAESHDMPPEKCFPGMDFEGKVKNEEEEQKKNKKKKTPTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.65
3 0.74
4 0.77
5 0.8
6 0.83
7 0.82
8 0.82
9 0.82
10 0.82
11 0.81
12 0.79
13 0.76
14 0.71
15 0.73
16 0.67
17 0.58
18 0.5
19 0.43
20 0.35
21 0.31
22 0.3
23 0.25
24 0.25
25 0.25
26 0.26
27 0.25
28 0.27
29 0.24
30 0.27
31 0.24
32 0.24
33 0.3
34 0.29
35 0.29
36 0.3
37 0.29
38 0.22
39 0.22
40 0.23
41 0.2
42 0.2
43 0.19
44 0.15
45 0.19
46 0.22
47 0.26
48 0.29
49 0.27
50 0.25
51 0.28
52 0.31
53 0.29
54 0.25
55 0.21
56 0.15
57 0.19
58 0.22
59 0.23
60 0.21
61 0.22
62 0.27
63 0.27
64 0.28
65 0.23
66 0.22
67 0.24
68 0.32
69 0.37
70 0.42
71 0.5
72 0.59
73 0.69
74 0.76
75 0.8
76 0.8