Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7T7S1

Protein Details
Accession M7T7S1   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-32SIPTSADPRSRRPTKKRALTPVSAQHydrophilic
129-161EERERRDEEKTRRNREKREKMKARKKNKGGGGGBasic
NLS Segment(s)
PositionSequence
126-192REREERERRDEEKTRRNREKREKMKARKKNKGGGGGGGVDAQKKNGALPNNKPSGKGVKGPRVNIAR
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
KEGG ela:UCREL1_269  -  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSGEGPESIPTSADPRSRRPTKKRALTPVSAQTASVEALFAHPEQEIRMPPPPPPSSSSTGTAVTISGRKPLPPPPEIVTNVQGSSAGAGSGEFHVYKASRRREYERLRRMDEEVKLEEEAARFEREREERERRDEEKTRRNREKREKMKARKKNKGGGGGGGVDAQKKNGALPNNKPSGKGVKGPRVNIARREDEKDGSSGGVGDKKEKAVAQGEPDKGTTAEETQGIIIAED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.34
3 0.44
4 0.54
5 0.64
6 0.7
7 0.76
8 0.8
9 0.87
10 0.88
11 0.89
12 0.86
13 0.82
14 0.79
15 0.77
16 0.72
17 0.61
18 0.52
19 0.42
20 0.35
21 0.29
22 0.22
23 0.13
24 0.07
25 0.08
26 0.09
27 0.08
28 0.08
29 0.08
30 0.08
31 0.09
32 0.12
33 0.14
34 0.16
35 0.21
36 0.21
37 0.24
38 0.31
39 0.32
40 0.32
41 0.34
42 0.36
43 0.37
44 0.39
45 0.39
46 0.34
47 0.32
48 0.3
49 0.25
50 0.2
51 0.17
52 0.16
53 0.13
54 0.15
55 0.15
56 0.16
57 0.18
58 0.25
59 0.29
60 0.28
61 0.32
62 0.3
63 0.36
64 0.37
65 0.37
66 0.33
67 0.29
68 0.27
69 0.23
70 0.2
71 0.14
72 0.12
73 0.09
74 0.05
75 0.04
76 0.04
77 0.04
78 0.05
79 0.06
80 0.05
81 0.05
82 0.07
83 0.07
84 0.12
85 0.2
86 0.27
87 0.32
88 0.36
89 0.42
90 0.5
91 0.6
92 0.66
93 0.68
94 0.66
95 0.64
96 0.62
97 0.59
98 0.54
99 0.46
100 0.39
101 0.31
102 0.27
103 0.23
104 0.21
105 0.18
106 0.13
107 0.12
108 0.1
109 0.1
110 0.09
111 0.1
112 0.15
113 0.16
114 0.2
115 0.27
116 0.34
117 0.37
118 0.43
119 0.49
120 0.46
121 0.52
122 0.57
123 0.58
124 0.59
125 0.65
126 0.69
127 0.73
128 0.78
129 0.81
130 0.84
131 0.86
132 0.87
133 0.88
134 0.89
135 0.89
136 0.93
137 0.92
138 0.92
139 0.91
140 0.88
141 0.85
142 0.8
143 0.78
144 0.68
145 0.61
146 0.52
147 0.42
148 0.35
149 0.28
150 0.22
151 0.15
152 0.14
153 0.12
154 0.1
155 0.1
156 0.11
157 0.14
158 0.21
159 0.25
160 0.33
161 0.41
162 0.49
163 0.49
164 0.48
165 0.48
166 0.48
167 0.45
168 0.45
169 0.45
170 0.46
171 0.51
172 0.52
173 0.57
174 0.58
175 0.59
176 0.59
177 0.58
178 0.56
179 0.54
180 0.59
181 0.54
182 0.49
183 0.46
184 0.4
185 0.34
186 0.26
187 0.22
188 0.17
189 0.16
190 0.17
191 0.15
192 0.17
193 0.19
194 0.2
195 0.22
196 0.22
197 0.23
198 0.23
199 0.26
200 0.31
201 0.36
202 0.38
203 0.37
204 0.37
205 0.35
206 0.31
207 0.29
208 0.24
209 0.18
210 0.17
211 0.16
212 0.16
213 0.15
214 0.16