Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7TY89

Protein Details
Accession M7TY89    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
94-118ELAPRRPAVQKRRRGKKQLPSQEVEHydrophilic
218-240STSASRPSGISKRQQRPKRNKARHydrophilic
NLS Segment(s)
PositionSequence
98-110RRPAVQKRRRGKK
208-240KRRRTAAGKTSTSASRPSGISKRQQRPKRNKAR
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
KEGG ela:UCREL1_1325  -  
Amino Acid Sequences MSWKHEQPLKDMLDEEMRDYDIARAQEPPLEADELAGAAPAPPGRNPFASSPPDERPHEPNQPEINIPNEPLQDPADDALHLAPLPNDNAEEEELAPRRPAVQKRRRGKKQLPSQEVEEGARPGDTAPLMPVHASRVSKAAPKKKGTSSQQRMNVSEPSIPDLPTTQPAPVTPRRSKRLREAESATKADVHTPVVPEGLSNDGAPQSKRRRTAAGKTSTSASRPSGISKRQQRPKRNKAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.25
4 0.23
5 0.21
6 0.21
7 0.2
8 0.17
9 0.18
10 0.17
11 0.17
12 0.17
13 0.2
14 0.2
15 0.2
16 0.18
17 0.18
18 0.17
19 0.15
20 0.14
21 0.11
22 0.1
23 0.08
24 0.06
25 0.04
26 0.06
27 0.07
28 0.08
29 0.09
30 0.13
31 0.16
32 0.18
33 0.2
34 0.23
35 0.28
36 0.31
37 0.34
38 0.37
39 0.4
40 0.44
41 0.45
42 0.46
43 0.45
44 0.47
45 0.52
46 0.47
47 0.49
48 0.47
49 0.45
50 0.43
51 0.39
52 0.35
53 0.27
54 0.28
55 0.23
56 0.2
57 0.18
58 0.18
59 0.17
60 0.14
61 0.14
62 0.13
63 0.11
64 0.09
65 0.09
66 0.07
67 0.07
68 0.06
69 0.06
70 0.05
71 0.06
72 0.07
73 0.06
74 0.07
75 0.07
76 0.08
77 0.08
78 0.09
79 0.08
80 0.11
81 0.12
82 0.12
83 0.12
84 0.1
85 0.13
86 0.18
87 0.26
88 0.33
89 0.42
90 0.51
91 0.62
92 0.73
93 0.79
94 0.83
95 0.84
96 0.83
97 0.84
98 0.85
99 0.8
100 0.72
101 0.66
102 0.58
103 0.5
104 0.41
105 0.31
106 0.2
107 0.15
108 0.11
109 0.09
110 0.06
111 0.06
112 0.05
113 0.05
114 0.05
115 0.05
116 0.06
117 0.06
118 0.06
119 0.07
120 0.1
121 0.11
122 0.11
123 0.12
124 0.13
125 0.19
126 0.26
127 0.32
128 0.36
129 0.41
130 0.45
131 0.49
132 0.56
133 0.6
134 0.64
135 0.64
136 0.65
137 0.68
138 0.66
139 0.63
140 0.57
141 0.5
142 0.41
143 0.34
144 0.26
145 0.23
146 0.21
147 0.19
148 0.17
149 0.16
150 0.15
151 0.16
152 0.17
153 0.13
154 0.12
155 0.13
156 0.19
157 0.25
158 0.32
159 0.38
160 0.45
161 0.53
162 0.59
163 0.64
164 0.68
165 0.72
166 0.69
167 0.68
168 0.67
169 0.68
170 0.67
171 0.63
172 0.53
173 0.44
174 0.39
175 0.33
176 0.28
177 0.21
178 0.17
179 0.17
180 0.17
181 0.16
182 0.15
183 0.13
184 0.13
185 0.13
186 0.12
187 0.1
188 0.11
189 0.13
190 0.16
191 0.17
192 0.25
193 0.32
194 0.39
195 0.44
196 0.47
197 0.53
198 0.59
199 0.68
200 0.69
201 0.69
202 0.65
203 0.62
204 0.63
205 0.56
206 0.5
207 0.44
208 0.36
209 0.3
210 0.28
211 0.33
212 0.37
213 0.41
214 0.49
215 0.56
216 0.65
217 0.72
218 0.8
219 0.84
220 0.87