Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7T4Y1

Protein Details
Accession M7T4Y1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
129-148NQRRAEWAKAHPKKPRGPKLBasic
NLS Segment(s)
PositionSequence
135-148WAKAHPKKPRGPKL
Subcellular Location(s) cyto 11.5, cyto_nucl 10.5, nucl 8.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029069  HotDog_dom_sf  
KEGG ela:UCREL1_997  -  
Pfam View protein in Pfam  
PF13279  4HBT_2  
Amino Acid Sequences MNAGFPHYASACNFRLFESFEEHLKDKLQDLMKVRGIGVIVKSSTIDIKRPVSYPDSIIVANRLDEVKPDRYHVTTTMWSLRQQAPVAESNGWVVFFDYSKGKPANLIEAGGVYANLHAALYEKSEITNQRRAEWAKAHPKKPRGPKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.25
4 0.25
5 0.26
6 0.25
7 0.25
8 0.29
9 0.29
10 0.28
11 0.28
12 0.27
13 0.21
14 0.26
15 0.26
16 0.27
17 0.3
18 0.35
19 0.36
20 0.35
21 0.34
22 0.28
23 0.26
24 0.23
25 0.19
26 0.15
27 0.12
28 0.11
29 0.11
30 0.11
31 0.14
32 0.14
33 0.15
34 0.17
35 0.2
36 0.22
37 0.22
38 0.24
39 0.24
40 0.24
41 0.23
42 0.2
43 0.19
44 0.17
45 0.16
46 0.15
47 0.12
48 0.11
49 0.1
50 0.09
51 0.07
52 0.09
53 0.13
54 0.17
55 0.17
56 0.19
57 0.2
58 0.21
59 0.22
60 0.21
61 0.21
62 0.16
63 0.18
64 0.19
65 0.19
66 0.19
67 0.21
68 0.22
69 0.22
70 0.21
71 0.19
72 0.18
73 0.19
74 0.2
75 0.17
76 0.15
77 0.13
78 0.13
79 0.12
80 0.1
81 0.08
82 0.06
83 0.06
84 0.08
85 0.09
86 0.1
87 0.14
88 0.15
89 0.14
90 0.17
91 0.18
92 0.22
93 0.2
94 0.2
95 0.16
96 0.15
97 0.16
98 0.12
99 0.11
100 0.06
101 0.05
102 0.04
103 0.04
104 0.04
105 0.03
106 0.05
107 0.06
108 0.08
109 0.09
110 0.09
111 0.1
112 0.14
113 0.22
114 0.26
115 0.33
116 0.33
117 0.34
118 0.41
119 0.43
120 0.45
121 0.44
122 0.49
123 0.53
124 0.61
125 0.67
126 0.69
127 0.75
128 0.79