Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SEF8

Protein Details
Accession M7SEF8   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
43-67DDPEKRRRKFAKFVKKNYRDQRRDSBasic
NLS Segment(s)
PositionSequence
43-58DDPEKRRRKFAKFVKK
Subcellular Location(s) mito 16, nucl 8, cyto_nucl 6.5
Family & Domain DBs
KEGG ela:UCREL1_8447  -  
Amino Acid Sequences MVSSRPTSSSGASIRSDGSKATAVSAVPSSSIAGSSGRRRFADDPEKRRRKFAKFVKKNYRDQRRDSIVTSSAPPVGNNKTPTSGQRQEGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.23
4 0.17
5 0.18
6 0.16
7 0.15
8 0.15
9 0.15
10 0.13
11 0.14
12 0.14
13 0.12
14 0.09
15 0.1
16 0.09
17 0.07
18 0.07
19 0.06
20 0.07
21 0.1
22 0.17
23 0.2
24 0.23
25 0.23
26 0.27
27 0.28
28 0.34
29 0.42
30 0.44
31 0.5
32 0.58
33 0.67
34 0.64
35 0.7
36 0.69
37 0.65
38 0.67
39 0.68
40 0.69
41 0.69
42 0.79
43 0.83
44 0.84
45 0.87
46 0.87
47 0.88
48 0.82
49 0.79
50 0.77
51 0.73
52 0.69
53 0.61
54 0.55
55 0.47
56 0.42
57 0.38
58 0.3
59 0.25
60 0.23
61 0.21
62 0.21
63 0.25
64 0.29
65 0.31
66 0.31
67 0.32
68 0.35
69 0.39
70 0.43
71 0.45