Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SA85

Protein Details
Accession M7SA85   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
102-131AGMTTLKPRDRSKRKGKAKKKKAAGGGGGSBasic
NLS Segment(s)
PositionSequence
108-130KPRDRSKRKGKAKKKKAAGGGGG
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, mito 8, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG ela:UCREL1_9999  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MARLSNDEFFAKLVQLFDSRKGKDHGSIFLTQKRLSHDQPLPEATSDTIFPDLHPPQPMPVLVRATNGKSKDRRKEKVKLSTVVDADALPAFFERYADVCKAGMTTLKPRDRSKRKGKAKKKKAAGGGGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.17
3 0.19
4 0.25
5 0.32
6 0.32
7 0.35
8 0.37
9 0.38
10 0.39
11 0.4
12 0.37
13 0.34
14 0.38
15 0.39
16 0.41
17 0.42
18 0.36
19 0.36
20 0.37
21 0.38
22 0.35
23 0.39
24 0.38
25 0.38
26 0.4
27 0.41
28 0.36
29 0.31
30 0.29
31 0.21
32 0.18
33 0.14
34 0.12
35 0.11
36 0.1
37 0.09
38 0.15
39 0.15
40 0.17
41 0.18
42 0.17
43 0.16
44 0.17
45 0.17
46 0.13
47 0.14
48 0.15
49 0.14
50 0.16
51 0.16
52 0.17
53 0.21
54 0.22
55 0.25
56 0.3
57 0.38
58 0.46
59 0.54
60 0.61
61 0.64
62 0.71
63 0.74
64 0.77
65 0.75
66 0.7
67 0.64
68 0.61
69 0.53
70 0.45
71 0.36
72 0.25
73 0.2
74 0.15
75 0.11
76 0.06
77 0.06
78 0.06
79 0.05
80 0.06
81 0.06
82 0.07
83 0.1
84 0.11
85 0.12
86 0.11
87 0.12
88 0.12
89 0.11
90 0.13
91 0.13
92 0.21
93 0.3
94 0.36
95 0.42
96 0.49
97 0.6
98 0.66
99 0.74
100 0.77
101 0.78
102 0.83
103 0.89
104 0.93
105 0.93
106 0.94
107 0.95
108 0.93
109 0.91
110 0.88
111 0.86