Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TLZ9

Protein Details
Accession M7TLZ9    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
88-110QKLGSKGHRLRKRGKLNMVYIPKHydrophilic
NLS Segment(s)
PositionSequence
93-101KGHRLRKRG
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 5, cyto 4
Family & Domain DBs
KEGG ela:UCREL1_5234  -  
Amino Acid Sequences MANSKSGQQDTTSSALVLDLLQQSISIKKDKDEIENSGSEYWVVNLPEFAQRDCWDLYMTHNESTVSAIDPTSKHSKDGFFVGRLNLQKLGSKGHRLRKRGKLNMVYIPKLEQC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.15
4 0.12
5 0.11
6 0.08
7 0.08
8 0.08
9 0.08
10 0.09
11 0.12
12 0.14
13 0.15
14 0.15
15 0.16
16 0.23
17 0.25
18 0.3
19 0.31
20 0.33
21 0.33
22 0.33
23 0.33
24 0.27
25 0.25
26 0.19
27 0.15
28 0.11
29 0.1
30 0.1
31 0.08
32 0.08
33 0.09
34 0.13
35 0.14
36 0.13
37 0.13
38 0.13
39 0.16
40 0.16
41 0.15
42 0.12
43 0.11
44 0.13
45 0.18
46 0.19
47 0.17
48 0.17
49 0.16
50 0.16
51 0.16
52 0.15
53 0.08
54 0.07
55 0.07
56 0.08
57 0.08
58 0.13
59 0.19
60 0.19
61 0.21
62 0.22
63 0.24
64 0.24
65 0.3
66 0.28
67 0.23
68 0.24
69 0.24
70 0.27
71 0.27
72 0.28
73 0.24
74 0.22
75 0.23
76 0.23
77 0.29
78 0.28
79 0.36
80 0.41
81 0.49
82 0.56
83 0.61
84 0.69
85 0.72
86 0.79
87 0.79
88 0.81
89 0.79
90 0.78
91 0.8
92 0.78
93 0.71
94 0.61