Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RDE9

Protein Details
Accession F4RDE9    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
87-114ESISSAVAKQKKRKRKATQSKSGSKEVCHydrophilic
NLS Segment(s)
PositionSequence
95-104KQKKRKRKAT
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG mlr:MELLADRAFT_61055  -  
Amino Acid Sequences MSSVTSECPSRSRKQPERAGMIAPSPDSRRRVSIDSVILASGQSPRHKKKNRMQQIEDTEDESDVVQSLSTKQKRKTASTKDVSDSESISSAVAKQKKRKRKATQSKSGSKEVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.74
3 0.77
4 0.78
5 0.73
6 0.66
7 0.57
8 0.49
9 0.4
10 0.32
11 0.27
12 0.23
13 0.26
14 0.27
15 0.28
16 0.29
17 0.31
18 0.34
19 0.34
20 0.35
21 0.32
22 0.3
23 0.28
24 0.25
25 0.21
26 0.17
27 0.13
28 0.11
29 0.11
30 0.16
31 0.23
32 0.29
33 0.39
34 0.47
35 0.57
36 0.63
37 0.71
38 0.76
39 0.79
40 0.77
41 0.75
42 0.74
43 0.69
44 0.6
45 0.5
46 0.4
47 0.3
48 0.26
49 0.17
50 0.1
51 0.06
52 0.05
53 0.04
54 0.04
55 0.07
56 0.15
57 0.21
58 0.27
59 0.31
60 0.37
61 0.42
62 0.5
63 0.57
64 0.59
65 0.63
66 0.65
67 0.65
68 0.63
69 0.6
70 0.54
71 0.45
72 0.36
73 0.27
74 0.2
75 0.16
76 0.12
77 0.11
78 0.11
79 0.17
80 0.23
81 0.29
82 0.38
83 0.48
84 0.59
85 0.69
86 0.77
87 0.81
88 0.87
89 0.91
90 0.92
91 0.93
92 0.93
93 0.93
94 0.88