Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4SCK5

Protein Details
Accession F4SCK5    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-25GEEVRPPPKRSRTNSNTSNSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR041320  CxC1  
KEGG mlr:MELLADRAFT_84820  -  
Pfam View protein in Pfam  
PF18802  CxC1  
Amino Acid Sequences MVLPGEEVRPPPKRSRTNSNTSNSSVGDRLANLLGRENAAAEGRMNVLQARPPVVAPVAPIPQADRAIREPQDQALYNAFIPEHGLDDLQEDDDKVERPAAGINRADYYRSETYQERVLKEEANWEKIMPALFLAYVPCSRSTFQWVDPVLWNHDFNDECRCPSWKRSTVNIDTIDWSGRTKTSLMTCRCTSDAVRLLRRGYIGGTPAQPRTAYSIRLLRFHHILWKYCSIRIAPFVEALDEYLDPRSSLLLVSGSDQTRDWRKGFSAAVDAYRELLQRQEDMTNEALQLSPEDILASTCPACFGPEVPGKRAEEPRVVVCLDGNFQQRRHLSASAAWRGESGVMPALFMSPLDVKSWETRMVPERNKRSDVIVSTVHKTFEIFKTVPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.75
3 0.76
4 0.79
5 0.83
6 0.81
7 0.76
8 0.7
9 0.66
10 0.56
11 0.5
12 0.41
13 0.33
14 0.27
15 0.21
16 0.21
17 0.19
18 0.2
19 0.17
20 0.2
21 0.19
22 0.19
23 0.18
24 0.16
25 0.15
26 0.14
27 0.14
28 0.11
29 0.11
30 0.12
31 0.12
32 0.12
33 0.12
34 0.12
35 0.16
36 0.17
37 0.19
38 0.18
39 0.17
40 0.19
41 0.18
42 0.17
43 0.16
44 0.18
45 0.18
46 0.18
47 0.18
48 0.18
49 0.2
50 0.24
51 0.23
52 0.22
53 0.23
54 0.3
55 0.32
56 0.33
57 0.31
58 0.31
59 0.35
60 0.32
61 0.3
62 0.26
63 0.25
64 0.22
65 0.21
66 0.18
67 0.12
68 0.13
69 0.11
70 0.1
71 0.09
72 0.09
73 0.08
74 0.1
75 0.11
76 0.1
77 0.1
78 0.08
79 0.09
80 0.1
81 0.11
82 0.1
83 0.11
84 0.1
85 0.1
86 0.15
87 0.16
88 0.2
89 0.2
90 0.21
91 0.22
92 0.23
93 0.23
94 0.19
95 0.24
96 0.22
97 0.22
98 0.24
99 0.23
100 0.25
101 0.31
102 0.35
103 0.29
104 0.29
105 0.29
106 0.28
107 0.27
108 0.34
109 0.3
110 0.29
111 0.28
112 0.25
113 0.24
114 0.23
115 0.23
116 0.14
117 0.1
118 0.07
119 0.06
120 0.07
121 0.07
122 0.07
123 0.08
124 0.09
125 0.1
126 0.11
127 0.12
128 0.13
129 0.19
130 0.21
131 0.21
132 0.27
133 0.26
134 0.26
135 0.29
136 0.29
137 0.27
138 0.26
139 0.25
140 0.19
141 0.21
142 0.19
143 0.17
144 0.24
145 0.2
146 0.2
147 0.21
148 0.24
149 0.23
150 0.29
151 0.37
152 0.36
153 0.39
154 0.45
155 0.52
156 0.52
157 0.56
158 0.51
159 0.43
160 0.37
161 0.34
162 0.28
163 0.2
164 0.16
165 0.11
166 0.1
167 0.1
168 0.08
169 0.1
170 0.15
171 0.23
172 0.25
173 0.29
174 0.3
175 0.31
176 0.31
177 0.3
178 0.25
179 0.23
180 0.27
181 0.26
182 0.28
183 0.28
184 0.28
185 0.27
186 0.27
187 0.22
188 0.16
189 0.13
190 0.12
191 0.12
192 0.14
193 0.15
194 0.15
195 0.16
196 0.15
197 0.14
198 0.19
199 0.18
200 0.17
201 0.18
202 0.24
203 0.24
204 0.29
205 0.3
206 0.26
207 0.26
208 0.25
209 0.3
210 0.27
211 0.29
212 0.28
213 0.35
214 0.34
215 0.33
216 0.34
217 0.28
218 0.26
219 0.27
220 0.25
221 0.18
222 0.18
223 0.16
224 0.15
225 0.14
226 0.13
227 0.1
228 0.08
229 0.07
230 0.08
231 0.08
232 0.07
233 0.07
234 0.07
235 0.06
236 0.06
237 0.06
238 0.06
239 0.06
240 0.08
241 0.12
242 0.11
243 0.12
244 0.12
245 0.16
246 0.21
247 0.25
248 0.24
249 0.22
250 0.24
251 0.27
252 0.27
253 0.25
254 0.23
255 0.21
256 0.22
257 0.21
258 0.2
259 0.18
260 0.18
261 0.17
262 0.12
263 0.14
264 0.13
265 0.13
266 0.15
267 0.15
268 0.15
269 0.17
270 0.19
271 0.17
272 0.16
273 0.15
274 0.13
275 0.11
276 0.11
277 0.09
278 0.07
279 0.06
280 0.06
281 0.06
282 0.06
283 0.07
284 0.08
285 0.08
286 0.07
287 0.08
288 0.08
289 0.09
290 0.09
291 0.1
292 0.15
293 0.22
294 0.26
295 0.27
296 0.33
297 0.34
298 0.39
299 0.45
300 0.42
301 0.4
302 0.4
303 0.4
304 0.38
305 0.36
306 0.3
307 0.25
308 0.22
309 0.18
310 0.2
311 0.25
312 0.26
313 0.26
314 0.33
315 0.33
316 0.36
317 0.39
318 0.35
319 0.3
320 0.32
321 0.41
322 0.41
323 0.4
324 0.36
325 0.32
326 0.31
327 0.3
328 0.25
329 0.17
330 0.15
331 0.14
332 0.14
333 0.14
334 0.14
335 0.13
336 0.12
337 0.13
338 0.1
339 0.11
340 0.12
341 0.14
342 0.16
343 0.2
344 0.23
345 0.25
346 0.23
347 0.28
348 0.35
349 0.44
350 0.51
351 0.57
352 0.64
353 0.67
354 0.7
355 0.66
356 0.63
357 0.6
358 0.54
359 0.49
360 0.46
361 0.43
362 0.44
363 0.44
364 0.4
365 0.33
366 0.31
367 0.31
368 0.28
369 0.32