Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RJP7

Protein Details
Accession F4RJP7    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-31VLAPRPPPLRQRNPIPERRPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 9, cyto 4
Family & Domain DBs
KEGG mlr:MELLADRAFT_62650  -  
Amino Acid Sequences MPLQRHQTQANVLAPRPPPLRQRNPIPERRPDPPTTSVKVEEQPKNAFEPVKLHPKKLNRLCLTLLMNDLSLTSTRIHTYRPSTKGRIIILKDLSKIPQPIPESARKVYKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.4
4 0.38
5 0.41
6 0.47
7 0.57
8 0.58
9 0.67
10 0.71
11 0.77
12 0.83
13 0.79
14 0.78
15 0.73
16 0.71
17 0.67
18 0.6
19 0.56
20 0.53
21 0.53
22 0.47
23 0.46
24 0.42
25 0.39
26 0.4
27 0.43
28 0.4
29 0.38
30 0.36
31 0.34
32 0.34
33 0.33
34 0.28
35 0.21
36 0.21
37 0.21
38 0.29
39 0.29
40 0.29
41 0.33
42 0.38
43 0.48
44 0.5
45 0.56
46 0.47
47 0.5
48 0.48
49 0.48
50 0.43
51 0.34
52 0.28
53 0.19
54 0.16
55 0.13
56 0.12
57 0.08
58 0.07
59 0.07
60 0.07
61 0.08
62 0.1
63 0.1
64 0.12
65 0.16
66 0.24
67 0.31
68 0.36
69 0.42
70 0.45
71 0.49
72 0.52
73 0.52
74 0.52
75 0.46
76 0.47
77 0.47
78 0.45
79 0.43
80 0.4
81 0.38
82 0.35
83 0.35
84 0.29
85 0.3
86 0.3
87 0.34
88 0.38
89 0.44
90 0.45
91 0.47