Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TP32

Protein Details
Accession M7TP32   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
107-129SDVKWGGKARKKQRQAIRKILDQHydrophilic
NLS Segment(s)
PositionSequence
113-120GKARKKQR
Subcellular Location(s) cyto 12.5, cyto_nucl 11.333, nucl 8, cyto_mito 7.666, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MAEFITNLIEMGAANFYRNTTGAFAQMKDMELQKWIRIVAVVGAYLLIRPYFINLGAKKQEKEYAKARAEHAEQKEKEKHVGANSFRDSAKASQDTDSEEDAKATSSDVKWGGKARKKQRQAIRKILDQEEMLRKQQQEDDEDKDIQEFLHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.11
5 0.12
6 0.12
7 0.12
8 0.13
9 0.18
10 0.2
11 0.19
12 0.21
13 0.22
14 0.21
15 0.2
16 0.21
17 0.16
18 0.18
19 0.19
20 0.17
21 0.18
22 0.17
23 0.15
24 0.14
25 0.13
26 0.11
27 0.1
28 0.09
29 0.07
30 0.07
31 0.07
32 0.06
33 0.06
34 0.04
35 0.04
36 0.04
37 0.06
38 0.06
39 0.07
40 0.13
41 0.14
42 0.19
43 0.25
44 0.28
45 0.27
46 0.29
47 0.34
48 0.3
49 0.34
50 0.35
51 0.38
52 0.39
53 0.4
54 0.4
55 0.38
56 0.38
57 0.4
58 0.39
59 0.39
60 0.36
61 0.4
62 0.43
63 0.4
64 0.39
65 0.34
66 0.32
67 0.27
68 0.32
69 0.29
70 0.3
71 0.31
72 0.31
73 0.29
74 0.27
75 0.25
76 0.2
77 0.23
78 0.19
79 0.19
80 0.18
81 0.19
82 0.21
83 0.21
84 0.21
85 0.17
86 0.15
87 0.14
88 0.13
89 0.13
90 0.1
91 0.09
92 0.1
93 0.08
94 0.12
95 0.14
96 0.15
97 0.17
98 0.23
99 0.32
100 0.37
101 0.46
102 0.54
103 0.62
104 0.69
105 0.76
106 0.8
107 0.81
108 0.83
109 0.85
110 0.8
111 0.77
112 0.75
113 0.68
114 0.61
115 0.52
116 0.49
117 0.47
118 0.44
119 0.41
120 0.39
121 0.37
122 0.37
123 0.4
124 0.38
125 0.36
126 0.37
127 0.41
128 0.41
129 0.41
130 0.38
131 0.34
132 0.3