Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7U1F2

Protein Details
Accession M7U1F2   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
32-57SRERLLKELKERRSRKERRSAAREVVBasic
NLS Segment(s)
PositionSequence
25-52KQHRDQGSRERLLKELKERRSRKERRSA
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
Amino Acid Sequences MTGHHRHRHSSHRHDSHNGSRGAEKQHRDQGSRERLLKELKERRSRKERRSAAREVVEGNRGTPWWFEMNESEHRIKKWMAEELEDKEIRNANEWNKAQELKQIRQCVYDRDRKHHALAMAEKKWNDTKVERDGKKRDRDQKLQEAWEKESNRWVEELEVADSYDNRNTGPDEDGVTWPRQSLVTINNDIRKRHLLRCIPSLQKPNSRGAHCKDCEDENETGPFWDEVRRLGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.78
4 0.75
5 0.67
6 0.58
7 0.53
8 0.51
9 0.53
10 0.53
11 0.48
12 0.47
13 0.54
14 0.57
15 0.56
16 0.57
17 0.58
18 0.61
19 0.64
20 0.61
21 0.54
22 0.53
23 0.57
24 0.57
25 0.57
26 0.56
27 0.59
28 0.64
29 0.67
30 0.73
31 0.77
32 0.82
33 0.81
34 0.83
35 0.83
36 0.82
37 0.85
38 0.83
39 0.8
40 0.74
41 0.65
42 0.58
43 0.51
44 0.45
45 0.37
46 0.3
47 0.23
48 0.19
49 0.18
50 0.15
51 0.14
52 0.13
53 0.13
54 0.14
55 0.16
56 0.2
57 0.24
58 0.28
59 0.3
60 0.3
61 0.3
62 0.31
63 0.29
64 0.29
65 0.27
66 0.28
67 0.25
68 0.26
69 0.29
70 0.3
71 0.35
72 0.32
73 0.28
74 0.24
75 0.26
76 0.23
77 0.22
78 0.22
79 0.19
80 0.27
81 0.28
82 0.28
83 0.27
84 0.28
85 0.26
86 0.29
87 0.31
88 0.28
89 0.34
90 0.36
91 0.34
92 0.38
93 0.38
94 0.39
95 0.4
96 0.43
97 0.4
98 0.41
99 0.47
100 0.44
101 0.45
102 0.4
103 0.35
104 0.3
105 0.34
106 0.35
107 0.32
108 0.32
109 0.3
110 0.29
111 0.3
112 0.28
113 0.25
114 0.2
115 0.22
116 0.3
117 0.39
118 0.41
119 0.47
120 0.55
121 0.6
122 0.67
123 0.7
124 0.71
125 0.7
126 0.75
127 0.75
128 0.76
129 0.73
130 0.7
131 0.67
132 0.6
133 0.55
134 0.54
135 0.47
136 0.38
137 0.39
138 0.34
139 0.29
140 0.27
141 0.23
142 0.17
143 0.17
144 0.17
145 0.12
146 0.11
147 0.1
148 0.1
149 0.1
150 0.1
151 0.1
152 0.09
153 0.08
154 0.09
155 0.1
156 0.12
157 0.14
158 0.13
159 0.14
160 0.16
161 0.18
162 0.2
163 0.2
164 0.19
165 0.17
166 0.17
167 0.15
168 0.13
169 0.14
170 0.17
171 0.21
172 0.27
173 0.31
174 0.37
175 0.41
176 0.41
177 0.42
178 0.45
179 0.44
180 0.45
181 0.5
182 0.52
183 0.53
184 0.6
185 0.64
186 0.62
187 0.64
188 0.67
189 0.65
190 0.66
191 0.63
192 0.65
193 0.64
194 0.63
195 0.63
196 0.62
197 0.65
198 0.58
199 0.6
200 0.54
201 0.5
202 0.49
203 0.46
204 0.41
205 0.34
206 0.34
207 0.3
208 0.27
209 0.25
210 0.22
211 0.17
212 0.2
213 0.18