Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S2K7

Protein Details
Accession F4S2K7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20KWCSTCCTYRPPRSSHCRMCHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, mito 9, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001594  Palmitoyltrfase_DHHC  
Gene Ontology GO:0016020  C:membrane  
GO:0019706  F:protein-cysteine S-palmitoyltransferase activity  
KEGG mlr:MELLADRAFT_30497  -  
Pfam View protein in Pfam  
PF01529  DHHC  
PROSITE View protein in PROSITE  
PS50216  DHHC  
Amino Acid Sequences KWCSTCCTYRPPRSSHCRMCDCCIDGLDHHCTYLNNCIGSRNYLYYLTFLITSVLSLVMIIGTSIWRVLNFHQSNQIGNHPISVSVLVISSIVLFPITTLLSYHVYLTFKGLTTVEHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.78
4 0.78
5 0.75
6 0.73
7 0.7
8 0.63
9 0.54
10 0.45
11 0.38
12 0.29
13 0.29
14 0.3
15 0.23
16 0.21
17 0.2
18 0.19
19 0.19
20 0.25
21 0.23
22 0.19
23 0.19
24 0.21
25 0.21
26 0.24
27 0.24
28 0.18
29 0.17
30 0.17
31 0.17
32 0.15
33 0.15
34 0.12
35 0.11
36 0.09
37 0.08
38 0.07
39 0.06
40 0.05
41 0.05
42 0.04
43 0.04
44 0.03
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.03
52 0.03
53 0.03
54 0.04
55 0.06
56 0.16
57 0.17
58 0.18
59 0.25
60 0.25
61 0.27
62 0.28
63 0.3
64 0.22
65 0.21
66 0.22
67 0.15
68 0.15
69 0.13
70 0.12
71 0.09
72 0.06
73 0.06
74 0.05
75 0.05
76 0.05
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.05
84 0.06
85 0.05
86 0.06
87 0.09
88 0.11
89 0.12
90 0.13
91 0.15
92 0.16
93 0.16
94 0.19
95 0.18
96 0.16
97 0.17
98 0.16