Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TXS6

Protein Details
Accession M7TXS6   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
2-22LISRYKTKYKELKKALKEAKEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MLISRYKTKYKELKKALKEAKEENVDGKIEDASAAVKRTDSKIKSLNSSIEKYTSKSRGYEKKYDEEFNGGCRANDKKSKAVDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.84
3 0.82
4 0.79
5 0.74
6 0.68
7 0.65
8 0.59
9 0.53
10 0.45
11 0.39
12 0.32
13 0.27
14 0.23
15 0.15
16 0.1
17 0.1
18 0.08
19 0.06
20 0.07
21 0.08
22 0.07
23 0.08
24 0.09
25 0.12
26 0.19
27 0.19
28 0.22
29 0.27
30 0.28
31 0.31
32 0.32
33 0.35
34 0.32
35 0.33
36 0.3
37 0.28
38 0.28
39 0.27
40 0.31
41 0.31
42 0.29
43 0.3
44 0.37
45 0.43
46 0.49
47 0.55
48 0.53
49 0.57
50 0.6
51 0.6
52 0.53
53 0.5
54 0.44
55 0.38
56 0.39
57 0.31
58 0.26
59 0.26
60 0.29
61 0.31
62 0.38
63 0.39
64 0.41