Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7UUA4

Protein Details
Accession M7UUA4   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-46EKTREEKAPKRAAKKTEKKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
17-43KTREEKAPKRAAKKTEKKKKDPNAPKR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MSYEELLAIAWSILREKTREEKAPKRAAKKTEKKKKDPNAPKRGLSAYMFFANEQRDNVREENPGISFGQVGKVLGERWKALNEKQRGPYEESAAKDKKRYEEEKANYNVSLTADAEEEESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.18
4 0.26
5 0.33
6 0.41
7 0.49
8 0.55
9 0.63
10 0.72
11 0.75
12 0.76
13 0.76
14 0.76
15 0.78
16 0.8
17 0.81
18 0.82
19 0.85
20 0.86
21 0.89
22 0.9
23 0.9
24 0.91
25 0.9
26 0.9
27 0.86
28 0.78
29 0.71
30 0.63
31 0.55
32 0.45
33 0.36
34 0.27
35 0.23
36 0.21
37 0.18
38 0.18
39 0.17
40 0.16
41 0.15
42 0.13
43 0.13
44 0.15
45 0.17
46 0.16
47 0.15
48 0.15
49 0.16
50 0.15
51 0.15
52 0.12
53 0.11
54 0.09
55 0.08
56 0.09
57 0.08
58 0.08
59 0.06
60 0.07
61 0.08
62 0.1
63 0.12
64 0.11
65 0.12
66 0.16
67 0.18
68 0.23
69 0.31
70 0.34
71 0.4
72 0.46
73 0.5
74 0.5
75 0.53
76 0.5
77 0.47
78 0.45
79 0.41
80 0.42
81 0.43
82 0.41
83 0.41
84 0.42
85 0.44
86 0.48
87 0.51
88 0.51
89 0.56
90 0.59
91 0.63
92 0.64
93 0.6
94 0.51
95 0.47
96 0.4
97 0.3
98 0.27
99 0.18
100 0.15
101 0.12
102 0.13