Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4SEM0

Protein Details
Accession F4SEM0   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
85-114SDAIIERHERNQKKKRRRIQPSQLCWKPPVHydrophilic
NLS Segment(s)
PositionSequence
94-102RNQKKKRRR
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR002717  HAT_MYST-type  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0004402  F:histone acetyltransferase activity  
GO:0016573  P:histone acetylation  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG mlr:MELLADRAFT_91986  -  
Pfam View protein in Pfam  
PF01853  MOZ_SAS  
PROSITE View protein in PROSITE  
PS51726  MYST_HAT  
Amino Acid Sequences MNLVKKKVNLVHQEKPLSDLGLLSYRAYWEEIIVGFILECVSKNEDVSIDEIAQKTAIVHGDVMHVCQTLHMLKYHDKQHVICLSDAIIERHERNQKKKRRRIQPSQLCWKPPVFSRAQLQFGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.57
3 0.49
4 0.4
5 0.32
6 0.24
7 0.18
8 0.17
9 0.18
10 0.14
11 0.13
12 0.13
13 0.13
14 0.14
15 0.12
16 0.08
17 0.09
18 0.08
19 0.09
20 0.08
21 0.07
22 0.06
23 0.06
24 0.06
25 0.04
26 0.05
27 0.06
28 0.08
29 0.09
30 0.09
31 0.09
32 0.09
33 0.1
34 0.11
35 0.1
36 0.08
37 0.1
38 0.1
39 0.1
40 0.09
41 0.08
42 0.07
43 0.07
44 0.07
45 0.05
46 0.05
47 0.05
48 0.08
49 0.08
50 0.08
51 0.07
52 0.07
53 0.07
54 0.07
55 0.08
56 0.07
57 0.08
58 0.09
59 0.11
60 0.16
61 0.21
62 0.27
63 0.29
64 0.31
65 0.3
66 0.35
67 0.37
68 0.35
69 0.29
70 0.24
71 0.21
72 0.21
73 0.21
74 0.15
75 0.13
76 0.14
77 0.15
78 0.22
79 0.31
80 0.35
81 0.45
82 0.54
83 0.63
84 0.71
85 0.81
86 0.84
87 0.86
88 0.9
89 0.91
90 0.92
91 0.93
92 0.92
93 0.92
94 0.88
95 0.81
96 0.74
97 0.66
98 0.57
99 0.52
100 0.49
101 0.42
102 0.41
103 0.46
104 0.49