Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7U481

Protein Details
Accession M7U481    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MASKSNPNVPQKKRKVANRAKTQRKNAINKITKNHydrophilic
NLS Segment(s)
PositionSequence
11-36QKKRKVANRAKTQRKNAINKITKNPR
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
Amino Acid Sequences MASKSNPNVPQKKRKVANRAKTQRKNAINKITKNPRGTRASTVLHPTSGPLAPLSGKKARKVQKAQNCARQRALEQAMKEGDVNMTEAAETIFKAANEGMEVDRVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.86
4 0.87
5 0.88
6 0.89
7 0.9
8 0.9
9 0.9
10 0.88
11 0.87
12 0.85
13 0.83
14 0.83
15 0.8
16 0.77
17 0.78
18 0.79
19 0.76
20 0.74
21 0.69
22 0.66
23 0.63
24 0.59
25 0.54
26 0.49
27 0.45
28 0.4
29 0.41
30 0.34
31 0.29
32 0.26
33 0.21
34 0.18
35 0.15
36 0.13
37 0.08
38 0.07
39 0.08
40 0.09
41 0.13
42 0.17
43 0.19
44 0.22
45 0.3
46 0.38
47 0.46
48 0.53
49 0.58
50 0.61
51 0.7
52 0.73
53 0.75
54 0.74
55 0.69
56 0.65
57 0.57
58 0.49
59 0.47
60 0.45
61 0.39
62 0.33
63 0.33
64 0.3
65 0.29
66 0.28
67 0.2
68 0.15
69 0.12
70 0.13
71 0.08
72 0.08
73 0.07
74 0.07
75 0.07
76 0.07
77 0.06
78 0.06
79 0.08
80 0.08
81 0.1
82 0.1
83 0.1
84 0.1
85 0.12
86 0.12