Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7U1K6

Protein Details
Accession M7U1K6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-27TPKPTGHPTKADKKKTKANTAANSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MQATPKPTGHPTKADKKKTKANTAANSKVVKPQPSSSTQTSSGESATPSQTRTIKIRNEGDSSNGGITDAYDKDERRIANRKEQNLKARKADPAPSTTQKFVGKMKGKVGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.77
3 0.76
4 0.81
5 0.81
6 0.83
7 0.82
8 0.81
9 0.8
10 0.8
11 0.78
12 0.74
13 0.67
14 0.57
15 0.55
16 0.5
17 0.45
18 0.39
19 0.37
20 0.36
21 0.39
22 0.44
23 0.39
24 0.39
25 0.38
26 0.36
27 0.33
28 0.29
29 0.24
30 0.19
31 0.16
32 0.13
33 0.14
34 0.13
35 0.12
36 0.15
37 0.16
38 0.18
39 0.21
40 0.25
41 0.26
42 0.31
43 0.35
44 0.35
45 0.35
46 0.33
47 0.32
48 0.27
49 0.25
50 0.19
51 0.14
52 0.11
53 0.08
54 0.08
55 0.08
56 0.07
57 0.09
58 0.11
59 0.12
60 0.14
61 0.18
62 0.18
63 0.22
64 0.31
65 0.33
66 0.42
67 0.49
68 0.55
69 0.61
70 0.67
71 0.72
72 0.71
73 0.72
74 0.69
75 0.65
76 0.63
77 0.58
78 0.58
79 0.52
80 0.48
81 0.5
82 0.51
83 0.52
84 0.48
85 0.49
86 0.44
87 0.44
88 0.44
89 0.47
90 0.47
91 0.47