Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RSF6

Protein Details
Accession F4RSF6   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
69-94VVSDAERKKRDKHRRHPQMTYKDARABasic
NLS Segment(s)
PositionSequence
75-83RKKRDKHRR
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
KEGG mlr:MELLADRAFT_72322  -  
Amino Acid Sequences MQGKIEDHQFIMTPRPNQSVTHYMSPIDQAVINSSRPVALSELSQSRNSTRRASDQHGNSFGAPSQSPVVSDAERKKRDKHRRHPQMTYKDARARDQQPPPNSLFEQFKGPSGEPNDPIQLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.34
3 0.34
4 0.34
5 0.39
6 0.39
7 0.39
8 0.4
9 0.37
10 0.33
11 0.32
12 0.32
13 0.26
14 0.19
15 0.15
16 0.1
17 0.13
18 0.14
19 0.14
20 0.13
21 0.13
22 0.12
23 0.11
24 0.12
25 0.09
26 0.08
27 0.09
28 0.12
29 0.16
30 0.18
31 0.19
32 0.18
33 0.21
34 0.25
35 0.27
36 0.27
37 0.26
38 0.3
39 0.34
40 0.38
41 0.42
42 0.42
43 0.43
44 0.42
45 0.4
46 0.34
47 0.29
48 0.24
49 0.18
50 0.13
51 0.1
52 0.09
53 0.08
54 0.08
55 0.09
56 0.11
57 0.1
58 0.15
59 0.22
60 0.3
61 0.36
62 0.39
63 0.46
64 0.55
65 0.66
66 0.72
67 0.75
68 0.77
69 0.83
70 0.88
71 0.9
72 0.89
73 0.88
74 0.85
75 0.8
76 0.76
77 0.71
78 0.66
79 0.6
80 0.58
81 0.54
82 0.54
83 0.58
84 0.59
85 0.57
86 0.59
87 0.57
88 0.54
89 0.5
90 0.46
91 0.41
92 0.34
93 0.37
94 0.33
95 0.34
96 0.33
97 0.32
98 0.34
99 0.35
100 0.39
101 0.34
102 0.37