Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TJC6

Protein Details
Accession M7TJC6   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
158-180LTLYPKPKEEPKKIWDRYRRRGHBasic
NLS Segment(s)
PositionSequence
123-131RKVARKKWK
166-180EEPKKIWDRYRRRGH
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, pero 2
Family & Domain DBs
Amino Acid Sequences MYNDFRGMKTRDHSPASEDADPLYDKNGKDLRGVMVAKWELYCKIGWVKRIFGKDEMYLPIVDCLPFPIRPNEMESEEWENVRSQGSESRTKWVLKAIEALKQDELWESLPYEQFKARHDEVRKVARKKWKIVGTRPRPSLDTIQAKYLDEIMNDVGLTLYPKPKEEPKKIWDRYRRRGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.47
4 0.44
5 0.37
6 0.3
7 0.29
8 0.28
9 0.24
10 0.21
11 0.2
12 0.18
13 0.25
14 0.28
15 0.27
16 0.28
17 0.3
18 0.28
19 0.3
20 0.31
21 0.24
22 0.26
23 0.26
24 0.24
25 0.23
26 0.22
27 0.16
28 0.16
29 0.16
30 0.12
31 0.2
32 0.22
33 0.28
34 0.29
35 0.34
36 0.38
37 0.42
38 0.42
39 0.37
40 0.37
41 0.32
42 0.32
43 0.28
44 0.24
45 0.21
46 0.18
47 0.16
48 0.13
49 0.12
50 0.09
51 0.09
52 0.1
53 0.11
54 0.12
55 0.15
56 0.16
57 0.17
58 0.2
59 0.2
60 0.21
61 0.2
62 0.22
63 0.24
64 0.23
65 0.22
66 0.19
67 0.17
68 0.15
69 0.14
70 0.12
71 0.07
72 0.11
73 0.15
74 0.22
75 0.22
76 0.26
77 0.28
78 0.28
79 0.28
80 0.28
81 0.25
82 0.18
83 0.24
84 0.21
85 0.24
86 0.24
87 0.25
88 0.21
89 0.2
90 0.19
91 0.14
92 0.14
93 0.09
94 0.09
95 0.08
96 0.1
97 0.12
98 0.12
99 0.13
100 0.15
101 0.16
102 0.17
103 0.23
104 0.24
105 0.29
106 0.32
107 0.37
108 0.42
109 0.51
110 0.57
111 0.55
112 0.59
113 0.62
114 0.66
115 0.65
116 0.67
117 0.65
118 0.65
119 0.71
120 0.76
121 0.76
122 0.78
123 0.76
124 0.69
125 0.62
126 0.58
127 0.54
128 0.52
129 0.5
130 0.43
131 0.43
132 0.42
133 0.41
134 0.37
135 0.35
136 0.27
137 0.18
138 0.18
139 0.14
140 0.13
141 0.12
142 0.11
143 0.08
144 0.07
145 0.09
146 0.1
147 0.15
148 0.16
149 0.18
150 0.22
151 0.32
152 0.42
153 0.5
154 0.56
155 0.6
156 0.7
157 0.77
158 0.83
159 0.84
160 0.85