Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TQW4

Protein Details
Accession M7TQW4   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-67VLYREHEKKRKEREEKKRKEQEEKEEKMBasic
NLS Segment(s)
PositionSequence
46-59EKKRKEREEKKRKE
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
Amino Acid Sequences MTFNSTELDNILRRLSSASQGRFHAGSTNQVPKLSIREAVLYREHEKKRKEREEKKRKEQEEKEEKMALIVANASAFTAPAVYGFSLVNSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.22
4 0.27
5 0.3
6 0.32
7 0.34
8 0.36
9 0.33
10 0.32
11 0.29
12 0.22
13 0.24
14 0.25
15 0.3
16 0.29
17 0.29
18 0.29
19 0.25
20 0.28
21 0.24
22 0.21
23 0.15
24 0.18
25 0.18
26 0.2
27 0.22
28 0.21
29 0.23
30 0.29
31 0.33
32 0.35
33 0.4
34 0.46
35 0.54
36 0.62
37 0.69
38 0.71
39 0.79
40 0.84
41 0.89
42 0.92
43 0.91
44 0.87
45 0.87
46 0.84
47 0.83
48 0.82
49 0.77
50 0.7
51 0.63
52 0.56
53 0.46
54 0.39
55 0.28
56 0.18
57 0.13
58 0.09
59 0.07
60 0.07
61 0.06
62 0.05
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.06
69 0.06
70 0.07
71 0.07