Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7U404

Protein Details
Accession M7U404   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-27IYQRGVTKRREIRRNFPDRGFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10, nucl 7, mito 5, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR025714  Methyltranfer_dom  
IPR026913  METTL24  
Pfam View protein in Pfam  
PF13383  Methyltransf_22  
Amino Acid Sequences MQESEIIYQRGVTKRREIRRNFPDRGFFPAKDESTFKETPWSIWDLVTPSYGCPWEMERLGRLGEGGWWICGISKFIEKEKPCVVYSFGVGNDSSFEAEILSRTKCEIWGYDQHVPGFNFGEEVTEEMRARAHFERNGANSATDDANRLVTIQDMMKRNGHDYIDILKTDIEYSEYNALSSLNGHTLPGGAGALTSPDPLKPEFPIGQILVEMHIFEWQGITASVYLDWWESMEYRGLRALHREIDTVAPGMGVEGGGIKLCSVSIPISFPWQNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.61
3 0.69
4 0.71
5 0.74
6 0.8
7 0.85
8 0.81
9 0.78
10 0.77
11 0.68
12 0.7
13 0.65
14 0.55
15 0.5
16 0.5
17 0.46
18 0.4
19 0.41
20 0.36
21 0.38
22 0.38
23 0.33
24 0.34
25 0.33
26 0.3
27 0.32
28 0.31
29 0.24
30 0.24
31 0.26
32 0.2
33 0.2
34 0.21
35 0.17
36 0.14
37 0.16
38 0.16
39 0.14
40 0.13
41 0.15
42 0.17
43 0.19
44 0.2
45 0.19
46 0.2
47 0.2
48 0.19
49 0.16
50 0.12
51 0.11
52 0.12
53 0.11
54 0.09
55 0.09
56 0.09
57 0.1
58 0.1
59 0.1
60 0.09
61 0.13
62 0.15
63 0.19
64 0.27
65 0.27
66 0.31
67 0.34
68 0.36
69 0.32
70 0.32
71 0.31
72 0.24
73 0.24
74 0.21
75 0.17
76 0.15
77 0.14
78 0.12
79 0.11
80 0.1
81 0.09
82 0.07
83 0.07
84 0.06
85 0.06
86 0.07
87 0.08
88 0.08
89 0.08
90 0.09
91 0.09
92 0.1
93 0.11
94 0.11
95 0.14
96 0.2
97 0.26
98 0.3
99 0.31
100 0.31
101 0.33
102 0.32
103 0.28
104 0.23
105 0.17
106 0.12
107 0.1
108 0.1
109 0.07
110 0.08
111 0.07
112 0.08
113 0.08
114 0.08
115 0.09
116 0.08
117 0.12
118 0.13
119 0.16
120 0.15
121 0.18
122 0.22
123 0.22
124 0.24
125 0.21
126 0.19
127 0.16
128 0.16
129 0.15
130 0.11
131 0.1
132 0.08
133 0.08
134 0.08
135 0.08
136 0.06
137 0.06
138 0.07
139 0.07
140 0.12
141 0.14
142 0.16
143 0.18
144 0.19
145 0.2
146 0.22
147 0.21
148 0.16
149 0.15
150 0.17
151 0.17
152 0.16
153 0.15
154 0.12
155 0.12
156 0.12
157 0.11
158 0.09
159 0.07
160 0.09
161 0.13
162 0.13
163 0.12
164 0.12
165 0.12
166 0.1
167 0.1
168 0.09
169 0.07
170 0.07
171 0.07
172 0.07
173 0.07
174 0.07
175 0.06
176 0.06
177 0.04
178 0.04
179 0.04
180 0.05
181 0.05
182 0.06
183 0.06
184 0.06
185 0.08
186 0.1
187 0.11
188 0.11
189 0.16
190 0.17
191 0.18
192 0.21
193 0.19
194 0.19
195 0.17
196 0.16
197 0.12
198 0.11
199 0.1
200 0.06
201 0.07
202 0.07
203 0.07
204 0.07
205 0.06
206 0.06
207 0.06
208 0.07
209 0.06
210 0.06
211 0.07
212 0.06
213 0.07
214 0.07
215 0.07
216 0.06
217 0.07
218 0.07
219 0.09
220 0.14
221 0.14
222 0.14
223 0.19
224 0.2
225 0.2
226 0.25
227 0.28
228 0.29
229 0.3
230 0.3
231 0.27
232 0.28
233 0.28
234 0.23
235 0.19
236 0.13
237 0.11
238 0.1
239 0.09
240 0.06
241 0.05
242 0.05
243 0.05
244 0.05
245 0.06
246 0.05
247 0.05
248 0.05
249 0.06
250 0.07
251 0.08
252 0.09
253 0.12
254 0.13
255 0.21