Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R9H9

Protein Details
Accession F4R9H9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
69-97EMERGKKDSEKKKKASTKKKGKQNTEVDDBasic
NLS Segment(s)
PositionSequence
72-90RGKKDSEKKKKASTKKKGK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_59976  -  
Amino Acid Sequences MTEVQTNTTTIEETTCPTSAYKNVDSKDPEDPSSAGKMVERQSVEAKLIFEVSDDEERDSISSSVEDGEMERGKKDSEKKKKASTKKKGKQNTEVDDLLNDDQVLKKNKTRYEGLIEHDHTLEGSRIKAPVIHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.16
5 0.18
6 0.21
7 0.26
8 0.29
9 0.32
10 0.33
11 0.38
12 0.41
13 0.41
14 0.44
15 0.41
16 0.36
17 0.32
18 0.32
19 0.28
20 0.28
21 0.26
22 0.18
23 0.16
24 0.19
25 0.19
26 0.23
27 0.21
28 0.2
29 0.22
30 0.23
31 0.23
32 0.2
33 0.18
34 0.14
35 0.14
36 0.11
37 0.09
38 0.08
39 0.1
40 0.11
41 0.11
42 0.11
43 0.1
44 0.11
45 0.11
46 0.11
47 0.09
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.05
55 0.07
56 0.09
57 0.09
58 0.09
59 0.09
60 0.1
61 0.14
62 0.22
63 0.31
64 0.4
65 0.49
66 0.55
67 0.65
68 0.74
69 0.81
70 0.83
71 0.84
72 0.84
73 0.84
74 0.88
75 0.87
76 0.86
77 0.85
78 0.83
79 0.78
80 0.72
81 0.65
82 0.55
83 0.45
84 0.4
85 0.3
86 0.21
87 0.15
88 0.1
89 0.11
90 0.16
91 0.22
92 0.23
93 0.27
94 0.34
95 0.39
96 0.43
97 0.45
98 0.45
99 0.48
100 0.49
101 0.49
102 0.51
103 0.48
104 0.45
105 0.41
106 0.36
107 0.27
108 0.25
109 0.22
110 0.15
111 0.15
112 0.15
113 0.15
114 0.16