Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TVK7

Protein Details
Accession M7TVK7    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
152-174NERQTQHSSRPKRKNPDISHRRPBasic
NLS Segment(s)
PositionSequence
143-150ARRKASSK
158-167HSSRPKRKNP
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MTCYQYLSIDGQPEPTTIPKIRCNEVLTTCGKESCAEIFKLPKCRVCTNEIIIYKCVHLQVKKSHRCEGCLLSKSRYPKSRPELRLIPHNENLYGGEVCENYLDHEELREKRKKLTSQERGGIEQLDRQRAAFDEEFEREERARRKASSKFNERQTQHSSRPKRKNPDISHRRPDMTAPTKPVLREHRRTQSHSYGQPESHRQVDPDYPNIPDVTFRRPTVIMHQEPTRPPYQGHQYTYVRECEPETQYYHTPVITSSHESITPAYEGHGYAGGYAGGYPHGQPNSQYTPFFSSATPPAWEQPQSPLIIEEDAQRYADWERQRQREEARPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.25
4 0.27
5 0.32
6 0.36
7 0.4
8 0.44
9 0.47
10 0.48
11 0.48
12 0.46
13 0.46
14 0.42
15 0.42
16 0.39
17 0.34
18 0.32
19 0.26
20 0.24
21 0.25
22 0.25
23 0.22
24 0.24
25 0.31
26 0.36
27 0.45
28 0.47
29 0.47
30 0.49
31 0.54
32 0.55
33 0.53
34 0.55
35 0.51
36 0.55
37 0.53
38 0.5
39 0.45
40 0.42
41 0.37
42 0.32
43 0.3
44 0.27
45 0.25
46 0.29
47 0.38
48 0.48
49 0.56
50 0.59
51 0.64
52 0.61
53 0.62
54 0.6
55 0.57
56 0.55
57 0.53
58 0.52
59 0.47
60 0.49
61 0.52
62 0.55
63 0.55
64 0.51
65 0.53
66 0.59
67 0.66
68 0.66
69 0.68
70 0.67
71 0.63
72 0.68
73 0.65
74 0.62
75 0.56
76 0.53
77 0.44
78 0.38
79 0.35
80 0.27
81 0.21
82 0.15
83 0.11
84 0.1
85 0.1
86 0.1
87 0.09
88 0.07
89 0.09
90 0.1
91 0.08
92 0.1
93 0.15
94 0.2
95 0.28
96 0.34
97 0.33
98 0.4
99 0.47
100 0.51
101 0.56
102 0.63
103 0.65
104 0.65
105 0.7
106 0.66
107 0.6
108 0.55
109 0.46
110 0.35
111 0.3
112 0.26
113 0.23
114 0.21
115 0.19
116 0.19
117 0.18
118 0.23
119 0.18
120 0.17
121 0.16
122 0.17
123 0.19
124 0.19
125 0.2
126 0.15
127 0.2
128 0.23
129 0.25
130 0.28
131 0.28
132 0.34
133 0.4
134 0.5
135 0.54
136 0.59
137 0.61
138 0.65
139 0.71
140 0.67
141 0.65
142 0.63
143 0.59
144 0.58
145 0.61
146 0.62
147 0.64
148 0.73
149 0.75
150 0.76
151 0.78
152 0.81
153 0.79
154 0.81
155 0.81
156 0.79
157 0.79
158 0.73
159 0.66
160 0.55
161 0.49
162 0.47
163 0.42
164 0.36
165 0.33
166 0.32
167 0.32
168 0.32
169 0.36
170 0.37
171 0.4
172 0.44
173 0.47
174 0.55
175 0.58
176 0.63
177 0.64
178 0.62
179 0.61
180 0.58
181 0.56
182 0.48
183 0.45
184 0.44
185 0.43
186 0.36
187 0.34
188 0.3
189 0.26
190 0.25
191 0.3
192 0.29
193 0.28
194 0.26
195 0.23
196 0.23
197 0.23
198 0.2
199 0.18
200 0.17
201 0.2
202 0.22
203 0.21
204 0.23
205 0.24
206 0.25
207 0.29
208 0.36
209 0.32
210 0.32
211 0.35
212 0.37
213 0.39
214 0.42
215 0.36
216 0.28
217 0.26
218 0.29
219 0.36
220 0.38
221 0.39
222 0.42
223 0.43
224 0.46
225 0.49
226 0.46
227 0.37
228 0.31
229 0.3
230 0.27
231 0.28
232 0.26
233 0.25
234 0.26
235 0.28
236 0.3
237 0.3
238 0.24
239 0.21
240 0.19
241 0.2
242 0.18
243 0.21
244 0.19
245 0.19
246 0.2
247 0.2
248 0.2
249 0.19
250 0.16
251 0.12
252 0.11
253 0.11
254 0.11
255 0.11
256 0.12
257 0.1
258 0.09
259 0.09
260 0.08
261 0.07
262 0.07
263 0.06
264 0.05
265 0.06
266 0.07
267 0.12
268 0.13
269 0.14
270 0.15
271 0.22
272 0.29
273 0.31
274 0.31
275 0.29
276 0.34
277 0.36
278 0.36
279 0.29
280 0.26
281 0.27
282 0.29
283 0.28
284 0.23
285 0.25
286 0.28
287 0.29
288 0.26
289 0.28
290 0.3
291 0.29
292 0.28
293 0.26
294 0.24
295 0.23
296 0.22
297 0.21
298 0.2
299 0.2
300 0.2
301 0.18
302 0.19
303 0.2
304 0.26
305 0.27
306 0.34
307 0.43
308 0.51
309 0.56
310 0.61
311 0.66