Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RYL1

Protein Details
Accession F4RYL1    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
182-206SQEKLSGKRYKRLKRKLQEYQDDTGHydrophilic
NLS Segment(s)
PositionSequence
188-197GKRYKRLKRK
Subcellular Location(s) mito 10, nucl 7, cyto_nucl 7, cysk 4, cyto 3
Family & Domain DBs
KEGG mlr:MELLADRAFT_66288  -  
Amino Acid Sequences MYGTQVYLCCIQGSIGFIQRLCQFILTPAGFCCTKISSHPKSISYIRIAMVFPPVLGHVSSGILPGLEAIVFHDQKPDPNAIPGGGSTSAEREMDFDIYIKRNLDIRYLHKIPDYIVQHVQTHGFLNRHEIEEIIEAIVPLEEETDDIRKLCYKTQTMLVYVQTMLRSEDPKVIAQREILKSQEKLSGKRYKRLKRKLQEYQDDTGLLWALMAQEIKRTCDVEDAATAANGAEPDAAAPPYTHTPHGTGLSGGLGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.21
4 0.2
5 0.24
6 0.26
7 0.26
8 0.23
9 0.21
10 0.16
11 0.17
12 0.25
13 0.21
14 0.2
15 0.19
16 0.22
17 0.21
18 0.21
19 0.22
20 0.15
21 0.16
22 0.23
23 0.32
24 0.35
25 0.44
26 0.48
27 0.47
28 0.51
29 0.53
30 0.51
31 0.45
32 0.41
33 0.33
34 0.31
35 0.29
36 0.25
37 0.24
38 0.18
39 0.14
40 0.12
41 0.12
42 0.1
43 0.1
44 0.1
45 0.07
46 0.08
47 0.08
48 0.08
49 0.07
50 0.06
51 0.06
52 0.05
53 0.05
54 0.04
55 0.04
56 0.05
57 0.11
58 0.12
59 0.12
60 0.17
61 0.17
62 0.2
63 0.23
64 0.24
65 0.19
66 0.2
67 0.21
68 0.16
69 0.16
70 0.14
71 0.13
72 0.1
73 0.1
74 0.08
75 0.09
76 0.1
77 0.1
78 0.1
79 0.09
80 0.09
81 0.1
82 0.09
83 0.09
84 0.11
85 0.12
86 0.14
87 0.13
88 0.13
89 0.16
90 0.16
91 0.2
92 0.21
93 0.23
94 0.3
95 0.31
96 0.31
97 0.28
98 0.28
99 0.25
100 0.28
101 0.26
102 0.2
103 0.22
104 0.22
105 0.22
106 0.22
107 0.21
108 0.15
109 0.14
110 0.14
111 0.12
112 0.11
113 0.15
114 0.16
115 0.16
116 0.15
117 0.14
118 0.12
119 0.12
120 0.12
121 0.08
122 0.06
123 0.05
124 0.05
125 0.05
126 0.04
127 0.03
128 0.03
129 0.03
130 0.03
131 0.04
132 0.06
133 0.06
134 0.06
135 0.07
136 0.11
137 0.12
138 0.15
139 0.2
140 0.2
141 0.22
142 0.28
143 0.29
144 0.28
145 0.29
146 0.26
147 0.21
148 0.19
149 0.19
150 0.13
151 0.12
152 0.11
153 0.11
154 0.12
155 0.12
156 0.16
157 0.16
158 0.19
159 0.22
160 0.22
161 0.21
162 0.23
163 0.29
164 0.28
165 0.29
166 0.28
167 0.29
168 0.28
169 0.3
170 0.34
171 0.3
172 0.3
173 0.37
174 0.44
175 0.44
176 0.51
177 0.59
178 0.62
179 0.7
180 0.78
181 0.8
182 0.8
183 0.87
184 0.9
185 0.9
186 0.9
187 0.85
188 0.78
189 0.69
190 0.59
191 0.48
192 0.38
193 0.28
194 0.17
195 0.11
196 0.08
197 0.06
198 0.07
199 0.07
200 0.07
201 0.12
202 0.14
203 0.17
204 0.18
205 0.19
206 0.18
207 0.22
208 0.23
209 0.2
210 0.2
211 0.19
212 0.17
213 0.16
214 0.15
215 0.1
216 0.1
217 0.08
218 0.07
219 0.05
220 0.05
221 0.06
222 0.07
223 0.08
224 0.08
225 0.08
226 0.11
227 0.17
228 0.2
229 0.22
230 0.22
231 0.25
232 0.28
233 0.31
234 0.28
235 0.23
236 0.21