Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7UAW8

Protein Details
Accession M7UAW8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
37-56GLSCINSRRRRRQGIQPMYGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 20, plas 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020999  Chitin_synth_reg_RCR  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF12273  RCR  
Amino Acid Sequences MAYSCDYYGNCYSTWGSWGRWVVLVLIILAFILLAFGLSCINSRRRRRQGIQPMYGTGWMAKPPPYGQYNQPAPYNYGPPPPMYTANGQIPPQQTGNTFNSNDGYYGHHGQHGQPDIELQQPPNAYTRGGDDVYQAPMGPPPTKHTEGDGIVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.19
4 0.22
5 0.24
6 0.23
7 0.23
8 0.23
9 0.2
10 0.18
11 0.17
12 0.12
13 0.09
14 0.08
15 0.06
16 0.05
17 0.04
18 0.03
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.03
25 0.03
26 0.05
27 0.08
28 0.17
29 0.26
30 0.35
31 0.46
32 0.55
33 0.64
34 0.69
35 0.76
36 0.8
37 0.8
38 0.78
39 0.69
40 0.62
41 0.53
42 0.48
43 0.37
44 0.26
45 0.17
46 0.11
47 0.11
48 0.1
49 0.11
50 0.11
51 0.15
52 0.16
53 0.18
54 0.2
55 0.27
56 0.3
57 0.31
58 0.32
59 0.29
60 0.3
61 0.29
62 0.29
63 0.22
64 0.21
65 0.19
66 0.18
67 0.19
68 0.18
69 0.19
70 0.17
71 0.18
72 0.18
73 0.21
74 0.22
75 0.21
76 0.22
77 0.22
78 0.22
79 0.21
80 0.18
81 0.16
82 0.19
83 0.22
84 0.23
85 0.22
86 0.21
87 0.22
88 0.21
89 0.2
90 0.16
91 0.16
92 0.16
93 0.18
94 0.18
95 0.18
96 0.19
97 0.19
98 0.25
99 0.25
100 0.21
101 0.18
102 0.19
103 0.19
104 0.22
105 0.22
106 0.17
107 0.17
108 0.17
109 0.18
110 0.2
111 0.2
112 0.16
113 0.15
114 0.18
115 0.19
116 0.2
117 0.19
118 0.18
119 0.2
120 0.22
121 0.21
122 0.17
123 0.13
124 0.15
125 0.19
126 0.19
127 0.18
128 0.22
129 0.3
130 0.33
131 0.34
132 0.35
133 0.38