Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7UUM6

Protein Details
Accession M7UUM6    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
163-182PPGIDPPKRSHKKKDPNAPABasic
NLS Segment(s)
PositionSequence
152-177GKRSHKRKEPPPPGIDPPKRSHKKKD
Subcellular Location(s) cyto 13.5cyto_nucl 13.5, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039723  Vps71/ZNHIT1  
IPR007529  Znf_HIT  
Gene Ontology GO:0005634  C:nucleus  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF04438  zf-HIT  
Amino Acid Sequences MNFGVLEIAPSKFVPAPGYAYVPDVANAPQIGLQPSARRARGPAGVGLGAETTKKQDAKILRELAQLDRENHRDVNIPVTGGRGKEGGRRNQSKLTPSVRKILASQKTFANHLSDFEALSSLPTTTTTTQQPATPTISVPKVAPAPGFTSTGKRSHKRKEPPPPGIDPPKRSHKKKDPNAPATSTPLRNMSTPLIKSEPATAIPTPAALPAPEESTFAPFLCSLPPPKPHPRDADPLLVSRVPNLPGREVMQRLLELPPLSYAEARGGCSDEDRRKPGRVFCEVCGYWGRVKCMRCGGRVCALDCLGIHKEECFNRYGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.2
4 0.21
5 0.24
6 0.22
7 0.22
8 0.22
9 0.2
10 0.18
11 0.15
12 0.14
13 0.14
14 0.13
15 0.11
16 0.12
17 0.14
18 0.16
19 0.16
20 0.18
21 0.19
22 0.27
23 0.33
24 0.33
25 0.32
26 0.33
27 0.36
28 0.39
29 0.37
30 0.33
31 0.29
32 0.28
33 0.26
34 0.24
35 0.19
36 0.14
37 0.12
38 0.1
39 0.1
40 0.15
41 0.16
42 0.16
43 0.22
44 0.28
45 0.34
46 0.43
47 0.45
48 0.43
49 0.45
50 0.47
51 0.44
52 0.44
53 0.41
54 0.36
55 0.36
56 0.37
57 0.36
58 0.35
59 0.33
60 0.3
61 0.27
62 0.28
63 0.23
64 0.2
65 0.18
66 0.2
67 0.21
68 0.16
69 0.17
70 0.14
71 0.14
72 0.21
73 0.28
74 0.34
75 0.42
76 0.48
77 0.51
78 0.56
79 0.59
80 0.57
81 0.57
82 0.56
83 0.55
84 0.52
85 0.54
86 0.49
87 0.46
88 0.44
89 0.46
90 0.45
91 0.39
92 0.39
93 0.35
94 0.35
95 0.36
96 0.33
97 0.28
98 0.2
99 0.19
100 0.19
101 0.16
102 0.15
103 0.13
104 0.12
105 0.08
106 0.08
107 0.07
108 0.05
109 0.05
110 0.06
111 0.08
112 0.09
113 0.12
114 0.13
115 0.15
116 0.16
117 0.17
118 0.18
119 0.18
120 0.2
121 0.17
122 0.16
123 0.17
124 0.17
125 0.16
126 0.15
127 0.14
128 0.13
129 0.13
130 0.13
131 0.11
132 0.12
133 0.13
134 0.16
135 0.14
136 0.17
137 0.19
138 0.26
139 0.3
140 0.34
141 0.4
142 0.46
143 0.55
144 0.61
145 0.68
146 0.72
147 0.76
148 0.78
149 0.76
150 0.71
151 0.68
152 0.69
153 0.65
154 0.59
155 0.54
156 0.57
157 0.61
158 0.61
159 0.64
160 0.65
161 0.71
162 0.75
163 0.8
164 0.8
165 0.79
166 0.79
167 0.72
168 0.63
169 0.58
170 0.53
171 0.43
172 0.34
173 0.29
174 0.26
175 0.23
176 0.23
177 0.2
178 0.22
179 0.21
180 0.23
181 0.22
182 0.21
183 0.21
184 0.21
185 0.19
186 0.15
187 0.18
188 0.15
189 0.14
190 0.13
191 0.13
192 0.11
193 0.1
194 0.09
195 0.06
196 0.08
197 0.07
198 0.1
199 0.1
200 0.11
201 0.11
202 0.13
203 0.14
204 0.13
205 0.13
206 0.1
207 0.1
208 0.11
209 0.13
210 0.13
211 0.17
212 0.23
213 0.29
214 0.39
215 0.44
216 0.48
217 0.53
218 0.56
219 0.59
220 0.58
221 0.58
222 0.5
223 0.47
224 0.44
225 0.38
226 0.32
227 0.26
228 0.25
229 0.2
230 0.23
231 0.22
232 0.21
233 0.21
234 0.24
235 0.27
236 0.26
237 0.26
238 0.23
239 0.22
240 0.21
241 0.21
242 0.21
243 0.16
244 0.15
245 0.15
246 0.14
247 0.15
248 0.14
249 0.13
250 0.15
251 0.16
252 0.17
253 0.16
254 0.16
255 0.15
256 0.19
257 0.27
258 0.31
259 0.36
260 0.42
261 0.45
262 0.5
263 0.55
264 0.58
265 0.57
266 0.58
267 0.56
268 0.52
269 0.58
270 0.51
271 0.49
272 0.45
273 0.4
274 0.37
275 0.37
276 0.4
277 0.36
278 0.38
279 0.41
280 0.47
281 0.49
282 0.49
283 0.51
284 0.5
285 0.54
286 0.56
287 0.52
288 0.47
289 0.42
290 0.37
291 0.32
292 0.32
293 0.26
294 0.23
295 0.22
296 0.19
297 0.25
298 0.28
299 0.3