Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TRB9

Protein Details
Accession M7TRB9   
Localization Confidence High
Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
182-206GSNGEKKRKLGKKMRILTRERRRTIBasic
217-251KESKEEADKERRARKNREKKVKRKAKEKALKAATGBasic
NLS Segment(s)
PositionSequence
183-206SNGEKKRKLGKKMRILTRERRRTI
215-247REKESKEEADKERRARKNREKKVKRKAKEKALK
Subcellular Location(s) nucl 20.5, mito_nucl 11.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MFDLPDAKRVRRSDLYTRSSSSSPEPPSPIDPDVSARFHDQLASLYGPISLQSCAIENTLTFEPMNDAPHSPPLEDDQDQAEEFDFRLFSNVTEGKIVLKEEAVDKGIFVVQERDKSYYFTGPIEGQRKEEYAIAAISGEDVLEGRGKRYWGLEVPWRVRVVKIGVGGQKKLGSNGLAVRNGSNGEKKRKLGKKMRILTRERRRTIEAQEQAMTREKESKEEADKERRARKNREKKVKRKAKEKALKAATGGIDQTEPGVDGADG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.63
4 0.64
5 0.6
6 0.53
7 0.49
8 0.43
9 0.41
10 0.4
11 0.4
12 0.39
13 0.38
14 0.41
15 0.43
16 0.39
17 0.33
18 0.29
19 0.29
20 0.31
21 0.29
22 0.28
23 0.26
24 0.25
25 0.24
26 0.23
27 0.19
28 0.16
29 0.17
30 0.16
31 0.14
32 0.13
33 0.12
34 0.11
35 0.11
36 0.11
37 0.08
38 0.07
39 0.07
40 0.08
41 0.09
42 0.1
43 0.09
44 0.08
45 0.12
46 0.13
47 0.13
48 0.12
49 0.11
50 0.14
51 0.15
52 0.18
53 0.14
54 0.15
55 0.15
56 0.21
57 0.21
58 0.18
59 0.18
60 0.19
61 0.22
62 0.21
63 0.21
64 0.18
65 0.19
66 0.19
67 0.18
68 0.15
69 0.1
70 0.1
71 0.1
72 0.08
73 0.06
74 0.08
75 0.08
76 0.08
77 0.13
78 0.13
79 0.13
80 0.14
81 0.14
82 0.13
83 0.14
84 0.14
85 0.09
86 0.08
87 0.08
88 0.09
89 0.1
90 0.1
91 0.09
92 0.08
93 0.09
94 0.09
95 0.09
96 0.08
97 0.11
98 0.11
99 0.15
100 0.17
101 0.19
102 0.19
103 0.21
104 0.22
105 0.19
106 0.19
107 0.15
108 0.16
109 0.15
110 0.2
111 0.23
112 0.22
113 0.21
114 0.21
115 0.21
116 0.2
117 0.19
118 0.14
119 0.1
120 0.09
121 0.08
122 0.07
123 0.06
124 0.05
125 0.04
126 0.03
127 0.02
128 0.02
129 0.03
130 0.06
131 0.06
132 0.07
133 0.08
134 0.09
135 0.1
136 0.1
137 0.12
138 0.11
139 0.14
140 0.2
141 0.25
142 0.27
143 0.3
144 0.3
145 0.28
146 0.27
147 0.27
148 0.22
149 0.18
150 0.18
151 0.19
152 0.23
153 0.24
154 0.24
155 0.23
156 0.24
157 0.21
158 0.21
159 0.18
160 0.14
161 0.13
162 0.18
163 0.21
164 0.2
165 0.2
166 0.19
167 0.19
168 0.19
169 0.2
170 0.22
171 0.24
172 0.32
173 0.36
174 0.4
175 0.49
176 0.55
177 0.64
178 0.67
179 0.71
180 0.73
181 0.77
182 0.83
183 0.82
184 0.82
185 0.83
186 0.84
187 0.84
188 0.77
189 0.72
190 0.68
191 0.64
192 0.64
193 0.63
194 0.57
195 0.5
196 0.49
197 0.45
198 0.42
199 0.44
200 0.37
201 0.29
202 0.31
203 0.28
204 0.29
205 0.32
206 0.36
207 0.36
208 0.43
209 0.49
210 0.52
211 0.59
212 0.63
213 0.7
214 0.73
215 0.75
216 0.78
217 0.82
218 0.83
219 0.87
220 0.9
221 0.91
222 0.93
223 0.95
224 0.95
225 0.93
226 0.93
227 0.92
228 0.92
229 0.91
230 0.88
231 0.88
232 0.83
233 0.76
234 0.66
235 0.62
236 0.52
237 0.43
238 0.35
239 0.26
240 0.19
241 0.17
242 0.16
243 0.11
244 0.1
245 0.08