Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7U729

Protein Details
Accession M7U729    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
278-310SGIVKPKPTPRVPKPPKEPKAPKEPKPAKEPKABasic
362-382ATPSSGKKRGRPAKEKTSDTPHydrophilic
NLS Segment(s)
PositionSequence
243-414REKPAPSGRGRGRPAKPDSEKKIKVPSGRGRGRPSSGIVKPKPTPRVPKPPKEPKAPKEPKPAKEPKAPKEPKPAKEPKAAKTPKSPKEKAVVEKKTPGKRGRPAKVPAAEGDVDEKPAATPSSGKKRGRPAKEKTSDTPASATPASKKRKASDDAGTPSSAGRGRPKKVKA
Subcellular Location(s) mito 14.5, cyto_mito 9.833, nucl 7.5, cyto_nucl 6.333, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MLRSISNSLNPLFGSPRKSTIEDRFEGEEGRKFTMSSPNDITLAEFNQTLARYPDLLNKYAKDAKEGVTPLQELDRFRYVEAPAKFKDGSHTFSIEDITKLVDWKLRHGAYRPGFLKKVGKNSDELVEAATKDAFDYYKTNPTDIGVVINKLKDPLMGIGPATASLILSVRYPDQVTFFSDECFKWLVNDGEHKPTPKYNVAEFEKIHAAAKSLTTRLRVNPLQIEKVAFVIIKESEPVLVPREKPAPSGRGRGRPAKPDSEKKIKVPSGRGRGRPSSGIVKPKPTPRVPKPPKEPKAPKEPKPAKEPKAPKEPKPAKEPKAAKTPKSPKEKAVVEKKTPGKRGRPAKVPAAEGDVDEKPAATPSSGKKRGRPAKEKTSDTPASATPASKKRKASDDAGTPSSAGRGRPKKVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.35
4 0.38
5 0.42
6 0.47
7 0.51
8 0.55
9 0.51
10 0.52
11 0.5
12 0.46
13 0.45
14 0.41
15 0.37
16 0.31
17 0.33
18 0.29
19 0.26
20 0.27
21 0.34
22 0.34
23 0.34
24 0.36
25 0.34
26 0.35
27 0.34
28 0.33
29 0.26
30 0.25
31 0.2
32 0.15
33 0.13
34 0.16
35 0.16
36 0.16
37 0.15
38 0.16
39 0.16
40 0.18
41 0.26
42 0.27
43 0.3
44 0.32
45 0.31
46 0.37
47 0.41
48 0.39
49 0.35
50 0.34
51 0.32
52 0.36
53 0.36
54 0.31
55 0.29
56 0.29
57 0.25
58 0.27
59 0.28
60 0.22
61 0.26
62 0.28
63 0.26
64 0.26
65 0.29
66 0.26
67 0.31
68 0.33
69 0.34
70 0.3
71 0.34
72 0.33
73 0.3
74 0.36
75 0.32
76 0.33
77 0.31
78 0.31
79 0.27
80 0.28
81 0.3
82 0.22
83 0.19
84 0.15
85 0.13
86 0.11
87 0.12
88 0.12
89 0.15
90 0.14
91 0.18
92 0.26
93 0.27
94 0.29
95 0.31
96 0.39
97 0.38
98 0.47
99 0.45
100 0.42
101 0.41
102 0.42
103 0.48
104 0.43
105 0.49
106 0.46
107 0.45
108 0.42
109 0.42
110 0.41
111 0.34
112 0.29
113 0.21
114 0.16
115 0.15
116 0.13
117 0.11
118 0.09
119 0.07
120 0.08
121 0.07
122 0.07
123 0.1
124 0.13
125 0.21
126 0.22
127 0.22
128 0.21
129 0.22
130 0.22
131 0.19
132 0.2
133 0.12
134 0.14
135 0.15
136 0.15
137 0.14
138 0.14
139 0.13
140 0.1
141 0.1
142 0.09
143 0.09
144 0.09
145 0.09
146 0.09
147 0.08
148 0.08
149 0.07
150 0.06
151 0.04
152 0.04
153 0.04
154 0.04
155 0.05
156 0.05
157 0.06
158 0.07
159 0.08
160 0.08
161 0.1
162 0.1
163 0.12
164 0.14
165 0.14
166 0.14
167 0.15
168 0.15
169 0.15
170 0.15
171 0.12
172 0.1
173 0.13
174 0.14
175 0.13
176 0.19
177 0.2
178 0.25
179 0.26
180 0.27
181 0.25
182 0.25
183 0.28
184 0.27
185 0.27
186 0.23
187 0.3
188 0.32
189 0.35
190 0.33
191 0.31
192 0.27
193 0.25
194 0.24
195 0.16
196 0.13
197 0.1
198 0.12
199 0.11
200 0.12
201 0.13
202 0.15
203 0.16
204 0.17
205 0.23
206 0.22
207 0.23
208 0.27
209 0.28
210 0.28
211 0.26
212 0.26
213 0.19
214 0.19
215 0.17
216 0.11
217 0.08
218 0.08
219 0.08
220 0.07
221 0.07
222 0.07
223 0.07
224 0.07
225 0.08
226 0.1
227 0.12
228 0.13
229 0.16
230 0.2
231 0.2
232 0.23
233 0.26
234 0.3
235 0.3
236 0.39
237 0.41
238 0.45
239 0.49
240 0.55
241 0.56
242 0.57
243 0.58
244 0.59
245 0.6
246 0.61
247 0.65
248 0.66
249 0.65
250 0.6
251 0.65
252 0.6
253 0.58
254 0.58
255 0.59
256 0.59
257 0.63
258 0.66
259 0.63
260 0.63
261 0.6
262 0.53
263 0.48
264 0.45
265 0.43
266 0.46
267 0.43
268 0.45
269 0.47
270 0.52
271 0.56
272 0.55
273 0.6
274 0.59
275 0.69
276 0.72
277 0.77
278 0.8
279 0.84
280 0.84
281 0.85
282 0.87
283 0.82
284 0.84
285 0.83
286 0.81
287 0.81
288 0.83
289 0.77
290 0.78
291 0.81
292 0.76
293 0.77
294 0.78
295 0.75
296 0.77
297 0.77
298 0.74
299 0.75
300 0.78
301 0.74
302 0.75
303 0.77
304 0.71
305 0.75
306 0.75
307 0.7
308 0.72
309 0.72
310 0.66
311 0.68
312 0.72
313 0.71
314 0.75
315 0.72
316 0.66
317 0.68
318 0.71
319 0.69
320 0.7
321 0.7
322 0.65
323 0.7
324 0.74
325 0.73
326 0.74
327 0.73
328 0.71
329 0.72
330 0.77
331 0.77
332 0.77
333 0.75
334 0.76
335 0.72
336 0.66
337 0.58
338 0.52
339 0.44
340 0.36
341 0.34
342 0.25
343 0.22
344 0.19
345 0.17
346 0.12
347 0.14
348 0.14
349 0.11
350 0.16
351 0.23
352 0.34
353 0.43
354 0.47
355 0.52
356 0.63
357 0.72
358 0.77
359 0.78
360 0.77
361 0.79
362 0.84
363 0.84
364 0.78
365 0.78
366 0.7
367 0.62
368 0.56
369 0.46
370 0.42
371 0.37
372 0.34
373 0.33
374 0.39
375 0.45
376 0.49
377 0.54
378 0.56
379 0.63
380 0.66
381 0.64
382 0.64
383 0.65
384 0.65
385 0.62
386 0.56
387 0.47
388 0.41
389 0.39
390 0.33
391 0.27
392 0.31
393 0.37
394 0.45